PDB entry 1w2e

View 1w2e on RCSB PDB site
Description: the crystal structure of the bacterial cell division protein zapa
Class: bacterial cell division
Keywords: bacterial cell division, ftsz modulator
Deposited on 2004-07-01, released 2004-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.24
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: zapa
    Species: PSEUDOMONAS AERUGINOSA [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2ea_
  • Chain 'B':
    Compound: zapa
    Species: PSEUDOMONAS AERUGINOSA [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2eb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w2eA (A:)
    msqsntltvqildkeycincpdderanlesaaryldgkmreirssgkvigadrvavmaal
    nithdllhrkerldqessstrervrelldrvdralanpadagea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2eA (A:)
    ntltvqildkeycincpdderanlesaaryldgkmreirssgkvigadrvavmaalnith
    dllhrkerldqessstrervrelldrvdrala
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w2eB (B:)
    msqsntltvqildkeycincpdderanlesaaryldgkmreirssgkvigadrvavmaal
    nithdllhrkerldqessstrervrelldrvdralanpadagea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2eB (B:)
    tltvqildkeycincpdderanlesaaryldgkmreirssgkvigadrvavmaalnithd
    llhrkerldqessstrervrelldrvdralan