PDB entry 1w2c

View 1w2c on RCSB PDB site
Description: human inositol (1,4,5) trisphosphate 3-kinase complexed with mn2+/amppnp/ins(1,4,5)p3
Class: transferase
Keywords: inositol phosphate kinase, amppnp, ip3, transferase
Deposited on 2004-07-01, released 2004-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.202
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inositol-trisphosphate 3-kinase a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2ca_
  • Chain 'B':
    Compound: inositol-trisphosphate 3-kinase a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2cb_
  • Heterogens: ANP, I3P, MN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2cA (A:)
    sfkaagtsglilkrcseperyclarlmadalrgcvpafhgvverdgesylqlqdlldgfd
    gpcvldckmgvrtyleeeltkarerpklrkdmykkmlavdpeapteeehaqravtkprym
    qwregisssttlgfriegikkadgscstdfkttrsreqvlrvfeefvqgdeevlrrylnr
    lqqirdtlevseffrrhevigssllfvhdhchragvwlidfgkttplpdgqildhrrpwe
    egnredgyllgldnligilaslaer
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w2cB (B:)
    sfkaagtsglilkrcseperyclarlmadalrgcvpafhgvverdgesylqlqdlldgfd
    gpcvldckmgvrtyleeeltkarerpklrkdmykkmlavdpeapteeehaqravtkprym
    qwregisssttlgfriegikkadgscstdfkttrsreqvlrvfeefvqgdeevlrrylnr
    lqqirdtlevseffrrhevigssllfvhdhchragvwlidfgkttplpdgqildhrrpwe
    egnredgyllgldnligilaslaer
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2cB (B:)
    sfkaagtsglilkrcseperyclarlmadalrgcvpafhgvverdgesylqlqdlldgfd
    gpcvldckmgvrtyleeeltkklrkdmykkmlavdpavtkprymqwregisssttlgfri
    egikkadgscstdfkttrsreqvlrvfeefvqgdeevlrrylnrlqqirdtlevseffrr
    hevigssllfvhdhchragvwlidfgkttplpdgqildhrrpweegnredgyllgldnli
    gilaslaer