PDB entry 1w2b

View 1w2b on RCSB PDB site
Description: Trigger Factor ribosome binding domain in complex with 50S
Class: ribosome
Keywords: ribosome, ribosome_associated factors, chaperone, nascent chain, cotranslational folding, RNA-binding, ribosomal protein
Deposited on 2004-07-01, released 2004-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: 23s rRNA
    Species: Haloarcula marismortui [TaxId:2238]
  • Chain '1':
    Compound: 50S ribosomal protein L39e
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2b1_
  • Chain '2':
    Compound: 50s ribosomal protein l44e la, hla, ribosomal protein l44e
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2b2_
  • Chain '5':
    Compound: Trigger Factor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • GB AAA62791
    Domains in SCOPe 2.07: d1w2b5_
  • Chain '9':
    Compound: 5s rRNA
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
  • Chain 'A':
    Compound: 50S ribosomal protein L2P
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2ba_
  • Chain 'B':
    Compound: 50S ribosomal protein L3P
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20279 (311-336)
      • conflict (309)
    Domains in SCOPe 2.07: d1w2bb_
  • Chain 'C':
    Compound: 50S ribosomal protein L4P
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2bc_
  • Chain 'D':
    Compound: 50s ribosomal protein l5p hmal5, hl13, ribosomal protein l5
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2bd_
  • Chain 'E':
    Compound: 50S ribosomal protein L6P
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2be_
  • Chain 'F':
    Compound: 50S ribosomal protein L7Ae
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2bf_
  • Chain 'G':
    Compound: 50S ribosomal protein L10e
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2bg_
  • Chain 'H':
    Compound: 50S ribosomal protein L10e
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2bh_
  • Chain 'I':
    Compound: 50S ribosomal protein L13P
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2bi_
  • Chain 'J':
    Compound: 50S ribosomal protein L14P
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2bj_
  • Chain 'K':
    Compound: 50S ribosomal protein L15P
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2bk_
  • Chain 'L':
    Compound: 50S ribosomal protein L15e
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2bl_
  • Chain 'M':
    Compound: 50S ribosomal protein L18P
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2bm_
  • Chain 'N':
    Compound: 50S ribosomal protein L18e
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2bn_
  • Chain 'O':
    Compound: 50S ribosomal protein L19e
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2bo_
  • Chain 'P':
    Compound: 50S ribosomal protein L21e
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2bp_
  • Chain 'Q':
    Compound: 50s ribosomal protein l22p hmal22, hl23, ribosomal protein l22
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: 50S ribosomal protein L23P
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2br_
  • Chain 'S':
    Compound: ribosomal protein l24
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2bs_
  • Chain 'T':
    Compound: 50S ribosomal protein L24P
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2bt_
  • Chain 'U':
    Compound: 50S ribosomal protein L24e
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2bu_
  • Chain 'V':
    Compound: 50S ribosomal protein L30P
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2bv_
  • Chain 'W':
    Compound: 50S ribosomal protein L31e
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2bw_
  • Chain 'X':
    Compound: 50S ribosomal protein L32e
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2bx_
  • Chain 'Y':
    Compound: 50S ribosomal protein L37Ae
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2by_
  • Chain 'Z':
    Compound: ribosomal protein l37e
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w2bz_
  • Heterogens: MG, K, NA, CL, CD, HOH

PDB Chain Sequences:

  • Chain '0':
    No sequence available.

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1w2b1 (1:)
    gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2b1 (1:)
    gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2b2 (2:)
    mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
    ptkktdlkyrcgecgkahlregwragrlefqe
    

  • Chain '5':
    Sequence, based on SEQRES records: (download)
    >1w2b5 (5:)
    mqvsvettqglgrrvtitiaadsietavkselvnvakkvridgfrkgkvpmnivaqryga
    svrqdvlgdlmsrnfidaiikekinpagaptyvpgeyklgedftysvefevypevelqgl
    eaievekpivevtdadvdgmldtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2b5 (5:)
    etavkselvnvakkvridgfrkgkvpmnivaqryg
    

  • Chain '9':
    No sequence available.

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w2bA (A:)
    grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
    edgdrrlilapegvgvgdelqvgvdaeiapgntlplaeipegvpvcnvesspgdggkfar
    asgvnaqllthdrnvavvklpsgemkrldpqcratigvvggggrtdkpfvkagnkhhkmk
    argtkwpnvrgvamnavdhpfggggrqhpgkpksisrnappgrkvgdiaskrtgrggne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2bA (A:)
    grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
    edgdrrlilapegvgvgdelqvgvdaeiapgntlplaeipegvpvcnvesspgdggkfar
    asgvnaqllthdrnvavvklpsgemkrldpqcratigvvggggrtdkpfvkagnkhhkmk
    argtkwpnvrgvamnavdhpfggggrqhpgkpksisrnappgrkvgdiaskrtgrggn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2bB (B:)
    pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns
    pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd
    pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald
    ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg
    pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs
    vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2bC (C:)
    mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
    fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
    adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
    argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
    aevaer
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w2bD (D:)
    ssesesggdfhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvge
    fdiregdpigakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeyd
    psigiygldvtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvevse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2bD (D:)
    fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
    lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
    hrlnpadavafiestydvevs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1w2bE (E:)
    prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
    tigtfqshienmfhgvtegweygmevfyshfpmqvnvegdevvienflgekaprrttihg
    dtdveidgeeltvsgpdieavgqtaadieqltrindkdvrvfqdgvyitrkpnrgda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2bE (E:)
    prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
    tigtfqshienmfhgvtegweygmevfyshfpmqvnvegdevvienflgekaprrttihg
    dtdveidgeeltvsgpdieavgqtaadieqltrindkdvrvfqdgvyitrkpn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2bF (F:)
    pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
    mhipeladekgvpfifveqqddlghaaglevgsaaaavtdagaaatvleeiadkveelr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1w2bG (G:)
    msaeserktetipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelr
    vsrntlleralddvddgledlngyitgqvgligtddnpfslfqeleasktpapigageva
    pndivipegdtgvdpgpfvgelqsvgadariqegsiqvlsdstvldtgeevsqelsnvln
    elgiepkevgldlravfadgvlfepeeleldideyrsdiqaaagrafnlsvnadyptatt
    aptmlqsdrgnakslalqaaiedpevvpdlvskadaqvralasqiddeealpeelqgvea
    dvateeptddqdddtaseddadaddaaeeadddddddedagdalgamf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2bG (G:)
    ipewkqeevdaivemiesrntlleralddv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1w2bH (H:)
    kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna
    leaarvaanryvqnsgaaanykfrirkfpfhvirenkaaaaaaaaaaadgmrapfgkpvg
    taarvhganhifiawvnpdpnveeawrrakmkvtptinidsspagna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2bH (H:)
    kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna
    leaarvaanryvqnsgaaanykfrirkfpfhvirenkdgmrapfgkpvgtaarvhganhi
    fiawvnpdpnveeawrrakmkvtptinidsspagna
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1w2bI (I:)
    msvaefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekr
    vdigndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgts
    ldrlsnikfvtlgeisetlganktw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2bI (I:)
    aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
    gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
    lsnikfvtlgeisetlganktw
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2bJ (J:)
    mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg
    tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
    fgsvasaatmiv
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1w2bK (K:)
    tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
    aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl
    iaddfsegarekvegaggsveltdlgeerqaeaeetedadadee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2bK (K:)
    tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
    aatidvreidenvtllaaddvaefrvdvrdvveeaddadyvkvlgagqvrheltliaddf
    segarekvegaggsveltdlgeerqa
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2bL (L:)
    arsaysyireawkrpkegqiaelmwhrmqewrnepavvrierptrldrarslgykakqgi
    ivvrvairkgssrrtrfnkgrrskrmmvnritrkkniqriaeeranrkfpnlrvlnsysv
    gedgrhkwhevilidpdhpaiksddqlswisrtrhrlrtfrgltsagrrcrglrgqgkgs
    ekvrpslrvngaka
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2bM (M:)
    atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
    ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
    gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
    dgdiel
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2bN (N:)
    sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
    pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1w2bO (O:)
    tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
    rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
    dlydkagggefdsvadleryidanhgda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2bO (O:)
    tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
    rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
    dlydkagggefdsvadleryidan
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2bP (P:)
    pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
    gtvegkqgdaykvdivdggkektiivtaahlrrqe
    

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2bR (R:)
    swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
    ekkavvrlsedddaqevasrigvf
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2bS (S:)
    skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
    evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1w2bT (T:)
    prtrecdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtargeag
    eaedea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2bT (T:)
    recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtarg
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1w2bU (U:)
    tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
    geegdlqene
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2bU (U:)
    tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
    geegdl
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2bV (V:)
    mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
    tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
    prgghdgvkhpvkeggqlgkhdtegiddlleamr
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1w2bW (W:)
    sasdfeervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawa
    rgrantpskirvraarfeeegeaiveaetae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2bW (W:)
    ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
    pskirvraarfeeegeaiveaet
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1w2bX (X:)
    adneedveaeeeyteltdisgvgpskaeslreagfesvedvrgadqsaladvsgignala
    arikadvggleveseteaeveeeggeeapdedvetelqargltektpdlsdedarlltqr
    hrvgkpqfnrqdhhkkkrvstswrkprgqlskqrrgikgkgdtveagfrsptavrgkhps
    gfeevrvhnvddlegvdgdteavriaskvgarkrerieeeaedagirvlnptyvevevse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2bX (X:)
    telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
    rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
    erieeeaedagirvlnptyveve
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2bY (Y:)
    rtgrfgpryglkirvrvadveikhkkkhkcpvcgfkklkragtgiwmcghcgykiaggcy
    qpetvagkavmka
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w2bZ (Z:)
    tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage