PDB entry 1w28

View 1w28 on RCSB PDB site
Description: conformational flexibility of the c-terminus with implications for substrate binding and catalysis in a new crystal form of deacetoxycephalosporin c synthase
Class: oxidoreductase
Keywords: oxidoreductase, cephalosporin, penicillin, mononuclear ferrous enzymes, 2-oxoglutarate dependent oxygenases
Deposited on 2004-06-30, released 2004-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.198
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deacetoxycephalosporin c synthase
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w28a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w28A (A:)
    mgsshhhhhhssglvprgshmdttvptfslaelqqglhqdefrrclrdkglfyltdcglt
    dtelksakdlvidffehgseaekravtspvptmrrgftglesestaqitntgsysdysmc
    ysmgtadnlfpsgdferiwtqyfdrqytasravarevlratgtepdggveafldcepllr
    fryfpqvpehrsaeeqplrmaphydlsmvtliqqtpcangfvslqaevggaftdlpyrpd
    avlvfcgaiatlvtggqvkaprhhvaaprrdqiagssrtssvfflrpnadftfsvplare
    cgfdvsldgetatfqdwiggnyvnirrtska
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w28A (A:)
    mdttvptfslaelqqglhqdefrrclrdkglfyltdcgltdtelksakdlvidffehgse
    aekravtspvptmrrgftgleysmcysmgtadnlfpsgdferiwtqyfdrqytasravar
    evlratgtepdggveafldcepllrfryfpqlrmaphydlsmvtliqqtpcangfvslqa
    evggaftdlpyrpdavlvfcgaiatlvtggqvkaprhhvaaprrdqiagssrtssvfflr
    pnadftfsvplarecgfdvsldgetatfqdwi