PDB entry 1w27

View 1w27 on RCSB PDB site
Description: phenylalanine ammonia-lyase (pal) from petroselinum crispum
Deposited on 2004-06-29, released 2004-11-25
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-08, with a file datestamp of 2004-12-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.16755
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1w27a_
  • Chain 'B':
    Domains in SCOP 1.71: d1w27b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w27A (A:)
    mengngattnghvngngmdfcmktedplywgiaaeamtgshldevkkmvaeyrkpvvklg
    getltisqvaaisardgsgvtvelseaaragvkassdwvmdsmnkgtdsygvttgfgats
    hrrtkqggalqkelirflnagifgngsdntlphsatraamlvrintllqgysgirfeile
    aitkflnqnitpclplrgtitasgdlvplsyiaglltgrpnskavgptgvilspeeafkl
    agveggffelqpkeglalvngtavgsgmasmvlfeanilavlaevmsaifaevmqgkpef
    tdhlthklkhhpgqieaaaimehildgsayvkaaqklhemdplqkpkqdryalrtspqwl
    gpqievirsstkmiereinsvndnplidvsrnkaihggnfqgtpigvsmdntrlaiaaig
    klmfaqfselvndfynnglpsnlsggrnpsldygfkgaeiamasycselqflanpvtnhv
    qsaeqhnqdvnslglissrktseaveilklmsttflvglcqaidlrhleenlkstvkntv
    ssvakrvltmgvngelhpsrfcekdllrvvdreyifayiddpcsatyplmqklrqtlveh
    alkngdnernlstsifqkiatfedelkallpkevesaraalesgnpaipnrieecrsypl
    ykfvrkelgteyltgekvtspgeefekvfiamskgeiidpllecleswngaplpic
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w27A (A:)
    edplywgiaaeamtgshldevkkmvaeyrkpvvklggetltisqvaaisardgsgvtvel
    seaaragvkassdwvmdsmnkgtdsygvttgfgatshrrtkqggalqkelirflnagifg
    ngsdntlphsatraamlvrintllqgysgirfeileaitkflnqnitpclplrgtitasg
    dlvplsyiaglltgrpnskavgptgvilspeeafklagveggffelqpkeglalvngtav
    gsgmasmvlfeanilavlaevmsaifaevmqgkpeftdhlthklkhhpgqieaaaimehi
    ldgsayvkaaqklhemdplqkpkqdryalrtspqwlgpqievirsstkmiereinsvndn
    plidvsrnkaihggnfqgtpigvsmdntrlaiaaigklmfaqfselvndfynnglpsnls
    ggrnpsldygfkgaeiamasycselqflanpvtnhvqsaeqhnqdvnslglissrktsea
    veilklmsttflvglcqaidlrhleenlkstvkntvssvakrvltmgvngelhpsrfcek
    dllrvvdreyifayiddpcsatyplmqklrqtlvehalkngdnernlstsifqkiatfed
    elkallpkevesaraalesgnpaipnrieecrsyplykfvrkelgteyltgekvtspgee
    fekvfiamskgeiidpllecleswngaplpic
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w27B (B:)
    mengngattnghvngngmdfcmktedplywgiaaeamtgshldevkkmvaeyrkpvvklg
    getltisqvaaisardgsgvtvelseaaragvkassdwvmdsmnkgtdsygvttgfgats
    hrrtkqggalqkelirflnagifgngsdntlphsatraamlvrintllqgysgirfeile
    aitkflnqnitpclplrgtitasgdlvplsyiaglltgrpnskavgptgvilspeeafkl
    agveggffelqpkeglalvngtavgsgmasmvlfeanilavlaevmsaifaevmqgkpef
    tdhlthklkhhpgqieaaaimehildgsayvkaaqklhemdplqkpkqdryalrtspqwl
    gpqievirsstkmiereinsvndnplidvsrnkaihggnfqgtpigvsmdntrlaiaaig
    klmfaqfselvndfynnglpsnlsggrnpsldygfkgaeiamasycselqflanpvtnhv
    qsaeqhnqdvnslglissrktseaveilklmsttflvglcqaidlrhleenlkstvkntv
    ssvakrvltmgvngelhpsrfcekdllrvvdreyifayiddpcsatyplmqklrqtlveh
    alkngdnernlstsifqkiatfedelkallpkevesaraalesgnpaipnrieecrsypl
    ykfvrkelgteyltgekvtspgeefekvfiamskgeiidpllecleswngaplpic
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w27B (B:)
    edplywgiaaeamtgshldevkkmvaeyrkpvvklggetltisqvaaisardgsgvtvel
    seaaragvkassdwvmdsmnkgtdsygvttgfgatshrrtkqggalqkelirflnagifg
    ngsdntlphsatraamlvrintllqgysgirfeileaitkflnqnitpclplrgtitasg
    dlvplsyiaglltgrpnskavgptgvilspeeafklagveggffelqpkeglalvngtav
    gsgmasmvlfeanilavlaevmsaifaevmqgkpeftdhlthklkhhpgqieaaaimehi
    ldgsayvkaaqklhemdplqkpkqdryalrtspqwlgpqievirsstkmiereinsvndn
    plidvsrnkaihggnfqgtpigvsmdntrlaiaaigklmfaqfselvndfynnglpsnls
    ggrnpsldygfkgaeiamasycselqflanpvtnhvqsaeqhnqdvnslglissrktsea
    veilklmsttflvglcqaidlrhleenlkstvkntvssvakrvltmgvngelhpsrfcek
    dllrvvdreyifayiddpcsatyplmqklrqtlvehalkngdnernlstsifqkiatfed
    elkallpkevesaraalesgnpaipnrieecrsyplykfvrkelgteyltgekvtspgee
    fekvfiamskgeiidpllecleswngaplpic