PDB entry 1w25

View 1w25 on RCSB PDB site
Description: response regulator pled in complex with c-digmp
Class: signaling protein
Keywords: two-component system, response regulator, diguanylate cyclase, ggdef domain, cyclic dinucleotide, cyclic-digmp, allosteric product inhibition, phosphorylation, signaling protein
Deposited on 2004-06-28, released 2004-11-18
The last revision prior to the SCOP 1.73 freeze date was dated 2007-06-19, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.21187
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: stalked-cell differentiation controlling protein
    Species: CAULOBACTER VIBRIOIDES
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9A5I5 (0-452)
    • PDB 1W25 (453-End)
    Domains in SCOP 1.73: d1w25a1, d1w25a2, d1w25a3
  • Chain 'B':
    Compound: stalked-cell differentiation controlling protein
    Species: CAULOBACTER VIBRIOIDES
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9A5I5 (0-452)
    • PDB 1W25 (453-End)
    Domains in SCOP 1.73: d1w25b1, d1w25b2, d1w25b3
  • Heterogens: ZN, MG, 5GP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w25A (A:)
    sarilvvddieanvrlleakltaeyyevstamdgptalamaardlpdiilldvmmpgmdg
    ftvcrklkddpttrhipvvlitaldgrgdriqglesgasdfltkpiddvmlfarvrsltr
    fklvidelrqreasgrrmgviagaaarldglggrvlivddnerqaqrvaaelgvehrpvi
    esdpekakisaggpvdlvivnaaaknfdglrftaalrseertrqlpvlamvdpddrgrmv
    kaleigvndilsrpidpqelsarvktqiqrkrytdylrnnldhslelavtdqltglhnrr
    ymtgqldslvkratlggdpvsallididffkkindtfghdigdevlrefalrlasnvrai
    dlpcryggeefvvimpdtaladalriaerirmhvsgspftvahgremlnvtisigvsata
    gegdtpeallkradegvyqakasgrnavvgkaahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w25A (A:)
    sarilvvddieanvrlleakltaeyyevstamdgptalamaardlpdiilldvmmpgmdg
    ftvcrklkddpttrhipvvlitaldgrgdriqglesgasdfltkpiddvmlfarvrsltr
    fklvidelrqreasgrrmgviagaaarldglggrvlivddnerqaqrvaaelgvehrpvi
    esdpekakisaggpvdlvivnaaaknfdglrftaalrseertrqlpvlamvdpddrgrmv
    kaleigvndilsrpidpqelsarvktqiqrkrytdylrnnldhslelavtdqltglhnrr
    ymtgqldslvkratlggdpvsallididffkkindtfghdigdevlrefalrlasnvrai
    dlpcryggeefvvimpdtaladalriaerirmhvsgspftvahgremlnvtisigvsata
    gegdtpeallkradegvyqakasgrnavvgkaah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w25B (B:)
    sarilvvddieanvrlleakltaeyyevstamdgptalamaardlpdiilldvmmpgmdg
    ftvcrklkddpttrhipvvlitaldgrgdriqglesgasdfltkpiddvmlfarvrsltr
    fklvidelrqreasgrrmgviagaaarldglggrvlivddnerqaqrvaaelgvehrpvi
    esdpekakisaggpvdlvivnaaaknfdglrftaalrseertrqlpvlamvdpddrgrmv
    kaleigvndilsrpidpqelsarvktqiqrkrytdylrnnldhslelavtdqltglhnrr
    ymtgqldslvkratlggdpvsallididffkkindtfghdigdevlrefalrlasnvrai
    dlpcryggeefvvimpdtaladalriaerirmhvsgspftvahgremlnvtisigvsata
    gegdtpeallkradegvyqakasgrnavvgkaahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w25B (B:)
    sarilvvddieanvrlleakltaeyyevstamdgptalamaardlpdiilldvmmpgmdg
    ftvcrklkddpttrhipvvlitaldgrgdriqglesgasdfltkpiddvmlfarvrsltr
    fklvidelrqreasgrrmgviagaaarldglggrvlivddnerqaqrvaaelgvehrpvi
    esdpekakisaggpvdlvivnaaaknfdglrftaalrseertrqlpvlamvdpddrgrmv
    kaleigvndilsrpidpqelsarvktqiqrkrytdylrnnldhslelavtdqltglhnrr
    ymtgqldslvkratlggdpvsallididffkkindtfghdigdevlrefalrlasnvrai
    dlpcryggeefvvimpdtaladalriaerirmhvsgspftvahgremlnvtisigvsata
    gegdtpeallkradegvyqakasgrnavvgkaah