PDB entry 1w25

View 1w25 on RCSB PDB site
Description: response regulator pled in complex with c-digmp
Deposited on 2004-06-28, released 2004-11-18
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-15, with a file datestamp of 2004-12-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.21187
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w25A (A:)
    sarilvvddieanvrlleakltaeyyevstamdgptalamaardlpdiilldvmmpgmdg
    ftvcrklkddpttrhipvvlitaldgrgdriqglesgasdfltkpiddvmlfarvrsltr
    fklvidelrqreasgrrmgviagaaarldglggrvlivddnerqaqrvaaelgvehrpvi
    esdpekakisaggpvdlvivnaaaknfdglrftaalrseertrqlpvlamvdpddrgrmv
    kaleigvndilsrpidpqelsarvktqiqrkrytdylrnnldhslelavtdqltglhnrr
    ymtgqldslvkratlggdpvsallididffkkindtfghdigdevlrefalrlasnvrai
    dlpcryggeefvvimpdtaladalriaerirmhvsgspftvahgremlnvtisigvsata
    gegdtpeallkradegvyqakasgrnavvgkaahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w25A (A:)
    sarilvvddieanvrlleakltaeyyevstamdgptalamaardlpdiilldvmmpgmdg
    ftvcrklkddpttrhipvvlitaldgrgdriqglesgasdfltkpiddvmlfarvrsltr
    fklvidelrqreasgrrmgviagaaarldglggrvlivddnerqaqrvaaelgvehrpvi
    esdpekakisaggpvdlvivnaaaknfdglrftaalrseertrqlpvlamvdpddrgrmv
    kaleigvndilsrpidpqelsarvktqiqrkrytdylrnnldhslelavtdqltglhnrr
    ymtgqldslvkratlggdpvsallididffkkindtfghdigdevlrefalrlasnvrai
    dlpcryggeefvvimpdtaladalriaerirmhvsgspftvahgremlnvtisigvsata
    gegdtpeallkradegvyqakasgrnavvgkaah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w25B (B:)
    sarilvvddieanvrlleakltaeyyevstamdgptalamaardlpdiilldvmmpgmdg
    ftvcrklkddpttrhipvvlitaldgrgdriqglesgasdfltkpiddvmlfarvrsltr
    fklvidelrqreasgrrmgviagaaarldglggrvlivddnerqaqrvaaelgvehrpvi
    esdpekakisaggpvdlvivnaaaknfdglrftaalrseertrqlpvlamvdpddrgrmv
    kaleigvndilsrpidpqelsarvktqiqrkrytdylrnnldhslelavtdqltglhnrr
    ymtgqldslvkratlggdpvsallididffkkindtfghdigdevlrefalrlasnvrai
    dlpcryggeefvvimpdtaladalriaerirmhvsgspftvahgremlnvtisigvsata
    gegdtpeallkradegvyqakasgrnavvgkaahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w25B (B:)
    sarilvvddieanvrlleakltaeyyevstamdgptalamaardlpdiilldvmmpgmdg
    ftvcrklkddpttrhipvvlitaldgrgdriqglesgasdfltkpiddvmlfarvrsltr
    fklvidelrqreasgrrmgviagaaarldglggrvlivddnerqaqrvaaelgvehrpvi
    esdpekakisaggpvdlvivnaaaknfdglrftaalrseertrqlpvlamvdpddrgrmv
    kaleigvndilsrpidpqelsarvktqiqrkrytdylrnnldhslelavtdqltglhnrr
    ymtgqldslvkratlggdpvsallididffkkindtfghdigdevlrefalrlasnvrai
    dlpcryggeefvvimpdtaladalriaerirmhvsgspftvahgremlnvtisigvsata
    gegdtpeallkradegvyqakasgrnavvgkaah