PDB entry 1w23

View 1w23 on RCSB PDB site
Description: crystal structure of phosphoserine aminotransferase from bacillus alcalophilus
Class: transferase
Keywords: aminotransferase, pyridoxal-5'-phosphate, transferase
Deposited on 2004-06-25, released 2004-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: 0.1174
AEROSPACI score: 0.96 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoserine aminotransferase
    Species: BACILLUS ALCALOPHILUS [TaxId:1445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w23a_
  • Chain 'B':
    Compound: phosphoserine aminotransferase
    Species: BACILLUS ALCALOPHILUS [TaxId:1445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w23b_
  • Heterogens: MG, PEG, PGE, CL, PLP, GOL, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w23A (A:)
    vkqvfnfnagpsalpkpaleraqkellnfndtqmsvmelshrsqsyeevheqaqnllrel
    lqipndyqilflqggaslqftmlpmnlltkgtignyvltgswsekalkeakllgethiaa
    stkansyqsipdfsefqlnendaylhitsnntiygtqyqnfpeinhapliadmssdilsr
    plkvnqfgmiyagaqknlgpsgvtvvivkkdllntkveqvptmlqyathiksdslyntpp
    tfsiymlrnvldwikdlggaeaiakqneekakiiydtidesngfyvghaekgsrslmnvt
    fnlrneelnqqflakakeqgfvglnghrsvggcrasiynavpidacialrelmiqfkena
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w23B (B:)
    vkqvfnfnagpsalpkpaleraqkellnfndtqmsvmelshrsqsyeevheqaqnllrel
    lqipndyqilflqggaslqftmlpmnlltkgtignyvltgswsekalkeakllgethiaa
    stkansyqsipdfsefqlnendaylhitsnntiygtqyqnfpeinhapliadmssdilsr
    plkvnqfgmiyagaqknlgpsgvtvvivkkdllntkveqvptmlqyathiksdslyntpp
    tfsiymlrnvldwikdlggaeaiakqneekakiiydtidesngfyvghaekgsrslmnvt
    fnlrneelnqqflakakeqgfvglnghrsvggcrasiynavpidacialrelmiqfkena
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w23B (B:)
    vkqvfnfnagpsalpkpaleraqkellnfndtqmsvmelshrsqsyeevheqaqnllrel
    lqipndyqilflqggaslqftmlpmnlltkgtignyvltgswsekalkeakllgethiaa
    stkansyqsipdfsefqlnendaylhitsnntiygtqyqnfpeinhapliadmssdilsr
    plkvnqfgmiyagaqknlgpsgvtvvivkkdllveqvptmlqyathiksdslyntpptfs
    iymlrnvldwikdlggaeaiakqneekakiiydtidesngfyvghaekgsrslmnvtfnl
    rneelnqqflakakeqgfvglnghrsvggcrasiynavpidacialrelmiqfkena