PDB entry 1w22

View 1w22 on RCSB PDB site
Description: Crystal structure of inhibited human HDAC8
Class: hydrolase
Keywords: hydroxamic acid, chromatin, deacetylation, hdac, hydrolase, nuclear protein, repressor
Deposited on 2004-06-25, released 2004-09-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.21
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone deacetylase 8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w22a_
  • Chain 'B':
    Compound: Histone deacetylase 8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w22b_
  • Heterogens: ZN, K, NHB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w22A (A:)
    meepeepadsgqslvpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpk
    vasmeematfhtdaylqhlqkvsqegdddhpdsieyglgydcpategifdyaaaiggati
    taaqclidgmckvainwsggwhhakkdeasgfcylndavlgilrlrrkferilyvdldlh
    hgdgvedafsftskvmtvslhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdeky
    yqicesvlkevyqafnpkavvlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatli
    lggggynlantarcwtyltgvilgktlsseipdhefftaygpdyvleitpscrpdrneph
    riqqilnyikgnlkhvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w22A (A:)
    slvpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfht
    daylqhlqkvsqeyglgydcpategifdyaaaiggatitaaqclidgmckvainwsggwh
    hakkdeasgfcylndavlgilrlrrkferilyvdldlhhgdgvedafsftskvmtvslhk
    fspgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlkevyqafnpkavvl
    qlgadtiagdpmcsfnmtpvgigkclkyilqwqlatlilggggynlantarcwtyltgvi
    lgktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyikgnlkh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w22B (B:)
    meepeepadsgqslvpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpk
    vasmeematfhtdaylqhlqkvsqegdddhpdsieyglgydcpategifdyaaaiggati
    taaqclidgmckvainwsggwhhakkdeasgfcylndavlgilrlrrkferilyvdldlh
    hgdgvedafsftskvmtvslhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdeky
    yqicesvlkevyqafnpkavvlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatli
    lggggynlantarcwtyltgvilgktlsseipdhefftaygpdyvleitpscrpdrneph
    riqqilnyikgnlkhvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w22B (B:)
    vpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfhtda
    ylqhlqkvsqeyglgydcpategifdyaaaiggatitaaqclidgmckvainwsggwhha
    kkdeasgfcylndavlgilrlrrkferilyvdldlhhgdgvedafsftskvmtvslhkfs
    pgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlkevyqafnpkavvlql
    gadtiagdpmcsfnmtpvgigkclkyilqwqlatlilggggynlantarcwtyltgvilg
    ktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyikgnlkh