PDB entry 1w21

View 1w21 on RCSB PDB site
Description: Structure of Neuraminidase from English duck subtype N6 complexed with 30 mM sialic acid (NANA, Neu5Ac), crystal soaked for 43 hours at 291 K.
Class: hydrolase
Keywords: influenza type a, neuraminidase, hb site, sialic acid, subtype n6, hydrolase
Deposited on 2004-06-25, released 2006-01-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w21a_
  • Chain 'B':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w21b_
  • Chain 'C':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w21c_
  • Chain 'D':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w21d_
  • Heterogens: SIA, GOL, NAG, BMA, MAN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w21A (A:)
    rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
    grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
    asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
    kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
    vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
    naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
    snsivalcgskkrlgswswhdgaeiiyfe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w21B (B:)
    rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
    grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
    asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
    kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
    vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
    naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
    snsivalcgskkrlgswswhdgaeiiyfe
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w21C (C:)
    rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
    grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
    asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
    kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
    vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
    naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
    snsivalcgskkrlgswswhdgaeiiyfe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w21D (D:)
    rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
    grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
    asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
    kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
    vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
    naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
    snsivalcgskkrlgswswhdgaeiiyfe