PDB entry 1w1x

View 1w1x on RCSB PDB site
Description: structure of neuraminidase from english duck subtype n6 complexed with 30 mm sialic acid (nana, neu5ac), crystal soaked for 3 hours at 277 k.
Class: hydrolase
Keywords: hydrolase, influenza type a, neuraminidase, hb site, sialic acid, subtype n6
Deposited on 2004-06-24, released 2006-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.167
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w1xa_
  • Chain 'B':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w1xb_
  • Chain 'C':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w1xc_
  • Chain 'D':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w1xd_
  • Heterogens: SIA, CA, BMA, MAN, NAG, GOL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w1xA (A:)
    rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
    grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
    asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
    kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
    vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
    naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
    snsivalcgskkrlgswswhdgaeiiyfe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w1xB (B:)
    rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
    grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
    asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
    kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
    vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
    naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
    snsivalcgskkrlgswswhdgaeiiyfe
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w1xC (C:)
    rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
    grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
    asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
    kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
    vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
    naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
    snsivalcgskkrlgswswhdgaeiiyfe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w1xD (D:)
    rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
    grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
    asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
    kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
    vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
    naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
    snsivalcgskkrlgswswhdgaeiiyfe