PDB entry 1w1w

View 1w1w on RCSB PDB site
Description: sc smc1hd:scc1-c complex, atpgs
Deposited on 2004-06-24, released 2004-09-30
The last revision prior to the SCOP 1.71 freeze date was dated 2004-09-30, with a file datestamp of 2004-09-30.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.2417
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1w1wa_
  • Chain 'B':
    Domains in SCOP 1.71: d1w1wb_
  • Chain 'C':
    Domains in SCOP 1.71: d1w1wc_
  • Chain 'D':
    Domains in SCOP 1.71: d1w1wd_
  • Chain 'E':
    Domains in SCOP 1.71: d1w1we_
  • Chain 'F':
    Domains in SCOP 1.71: d1w1wf_
  • Chain 'G':
    Domains in SCOP 1.71: d1w1wg_
  • Chain 'H':
    Domains in SCOP 1.71: d1w1wh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w1wA (A:)
    mgrlvglelsnfksyrgvtkvgfgesnftsiigpngsgksnmmdaisfvlgvrsnhlrsn
    ilkdliyrgvlndensddydnegaassnpqsayvkafyqkgnklvelmriisrngdtsyk
    idgktvsykdysiflenenilikaknflvfqgdveqiaaqspvelsrmfeevsgsiqykk
    eyeelkekieklsksatesiknrrrihgelktykspglevlfqgprgsrydeaegrfevi
    nneteqlkaeekkilnqflkikkkrkelfektfdyvsdhldaiyreltknpnsnvelagg
    nasltiededepfnagikyhatpplkrfkdmeylsggektvaalallfainsyqpspffv
    ldevdaalditnvqriaayirrhrnpdlqfivislkntmfeksdalvgvyrqqqensski
    itldlsnyae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1wA (A:)
    grlvglelsnfksyrgvtkvgfgesnftsiigpngsgksnmmdaisfvlgvlkdliyrgp
    qsayvkafyqkgnklvelmriisrngdtsykidgktvsykdysiflenenilikaknflv
    fqgdveqiaaqspvelsrmftfdyvsdhldaiyreltgnasltkyhatpplkrfkdmeyl
    sggektvaalallfainsyqpspffvldevdaalditnvqriaayirrhrnpdlqfivis
    lkntmfeksdalvgvyrqqqensskiitldlsny
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w1wB (B:)
    mgrlvglelsnfksyrgvtkvgfgesnftsiigpngsgksnmmdaisfvlgvrsnhlrsn
    ilkdliyrgvlndensddydnegaassnpqsayvkafyqkgnklvelmriisrngdtsyk
    idgktvsykdysiflenenilikaknflvfqgdveqiaaqspvelsrmfeevsgsiqykk
    eyeelkekieklsksatesiknrrrihgelktykspglevlfqgprgsrydeaegrfevi
    nneteqlkaeekkilnqflkikkkrkelfektfdyvsdhldaiyreltknpnsnvelagg
    nasltiededepfnagikyhatpplkrfkdmeylsggektvaalallfainsyqpspffv
    ldevdaalditnvqriaayirrhrnpdlqfivislkntmfeksdalvgvyrqqqensski
    itldlsnyae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1wB (B:)
    grlvglelsnfksyrgvtkvgfgesnftsiigpngsgksnmmdaisfvlgvrslkdliyr
    gpqsayvkafyqkgnklvelmriisrngdtsykidgktvsykdysiflenenilikaknf
    lvfqgdveqiaaqspvelsrmfeevsgsiqykkeyeelkekikilnqflkikkkrkelfe
    ktfdyvsdhldaiyreltgnasltiededepfnagikyhatpplkrfkdmeylsggektv
    aalallfainsyqpspffvldevdaalditnvqriaayirrhrnpdlqfivislkntmfe
    ksdalvgvyrqqqensskiitldlsny
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w1wC (C:)
    mgrlvglelsnfksyrgvtkvgfgesnftsiigpngsgksnmmdaisfvlgvrsnhlrsn
    ilkdliyrgvlndensddydnegaassnpqsayvkafyqkgnklvelmriisrngdtsyk
    idgktvsykdysiflenenilikaknflvfqgdveqiaaqspvelsrmfeevsgsiqykk
    eyeelkekieklsksatesiknrrrihgelktykspglevlfqgprgsrydeaegrfevi
    nneteqlkaeekkilnqflkikkkrkelfektfdyvsdhldaiyreltknpnsnvelagg
    nasltiededepfnagikyhatpplkrfkdmeylsggektvaalallfainsyqpspffv
    ldevdaalditnvqriaayirrhrnpdlqfivislkntmfeksdalvgvyrqqqensski
    itldlsnyae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1wC (C:)
    grlvglelsnfksyrgvtkvgfgesnftsiigpngsgksnmmdaisfvlgvrslkdliyr
    gpqsayvkafyqkgnklvelmriisrngdtsykidgktvsykdysiflenenilikaknf
    lvfqgdveqiaaqspvelsrmfeevsgsiqykkeyeelkekikilnqflkikkkrkelfe
    ktfdyvsdhldaiyreltgnasltiededepfnagikyhatpplkrfkdmeylsggektv
    aalallfainsyqpspffvldevdaalditnvqriaayirrhrnpdlqfivislkntmfe
    ksdalvgvyrqqqensskiitldlsny
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w1wD (D:)
    mgrlvglelsnfksyrgvtkvgfgesnftsiigpngsgksnmmdaisfvlgvrsnhlrsn
    ilkdliyrgvlndensddydnegaassnpqsayvkafyqkgnklvelmriisrngdtsyk
    idgktvsykdysiflenenilikaknflvfqgdveqiaaqspvelsrmfeevsgsiqykk
    eyeelkekieklsksatesiknrrrihgelktykspglevlfqgprgsrydeaegrfevi
    nneteqlkaeekkilnqflkikkkrkelfektfdyvsdhldaiyreltknpnsnvelagg
    nasltiededepfnagikyhatpplkrfkdmeylsggektvaalallfainsyqpspffv
    ldevdaalditnvqriaayirrhrnpdlqfivislkntmfeksdalvgvyrqqqensski
    itldlsnyae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1wD (D:)
    grlvglelsnfksyrgvtkvgfgesnftsiigpngsgksnmmdaisfvlgvrslkdliyr
    gpqsayvkafyqkgnklvelmriisrngdtsykidgktvsykdysiflenenilikaknf
    lvfqgdveqiaaqspvelsrmfeevsgsiqykkeyeelkekikilnqflkikkkrkelfe
    ktfdyvsdhldaiyreltgnasltiededepfnagikyhatpplkrfkdmeylsggektv
    aalallfainsyqpspffvldevdaalditnvqriaayirrhrnpdlqfivislkntmfe
    ksdalvgvyrqqqensskiitldlsny
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1w1wE (E:)
    mhhhhhhfpeeniidaktrneqttiqtekvrptpgevaskaivqmakilrkelseekevi
    ftdvlksqantepenitkreasrgffdilslategciglsqteafgnikidakpalferf
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1wE (E:)
    kaivqmakilrkelseekeviftdvlksqakreasrgffdilslategciglsqteafgn
    ikidakpalfe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1w1wF (F:)
    mhhhhhhfpeeniidaktrneqttiqtekvrptpgevaskaivqmakilrkelseekevi
    ftdvlksqantepenitkreasrgffdilslategciglsqteafgnikidakpalferf
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1wF (F:)
    kaivqmakilrkelseekeviftdvlksqakreasrgffdilslategciglsqteafgn
    ikidakpalfe
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1w1wG (G:)
    mhhhhhhfpeeniidaktrneqttiqtekvrptpgevaskaivqmakilrkelseekevi
    ftdvlksqantepenitkreasrgffdilslategciglsqteafgnikidakpalferf
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1wG (G:)
    kaivqmakilrkelseekeviftdvlksqakreasrgffdilslategciglsqteafgn
    ikidakpalfe
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1w1wH (H:)
    mhhhhhhfpeeniidaktrneqttiqtekvrptpgevaskaivqmakilrkelseekevi
    ftdvlksqantepenitkreasrgffdilslategciglsqteafgnikidakpalferf
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1wH (H:)
    kaivqmakilrkelseekeviftdvlksqakreasrgffdilslategciglsqteafgn
    ikidakpalfe