PDB entry 1w1v

View 1w1v on RCSB PDB site
Description: crystal structure of s. marcescens chitinase b in complex with the cyclic dipeptide inhibitor cyclo-(l-arg-l-pro) at 1.85 a resolution
Class: hydrolase
Keywords: hydrolase, glycoside hydrolase, chitinase, structure-based inhibitor design, cyclic dipeptide
Deposited on 2004-06-24, released 2005-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.187
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase b
    Species: Serratia marcescens [TaxId:615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w1va1, d1w1va2, d1w1va3
  • Chain 'B':
    Compound: chitinase b
    Species: Serratia marcescens [TaxId:615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w1vb1, d1w1vb2, d1w1vb3
  • Heterogens: GOL, SO4, ALJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w1vA (A:)
    mstrkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlec
    awdpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasr
    akfaqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyq
    ltiagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfy
    nalreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfygrafkgvs
    ggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqgnygyqrlwn
    dktktpylyhaqnglfvtyddaesfkykakyikqqqlggvmfwhlgqdnrngdllaaldr
    yfnaadyddsqldmgtglrytgvgpgnlpimtapayvpgttyaqgalvsyqgyvwqtkwg
    yitsapgsdsawlkvgrva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1vA (A:)
    trkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecaw
    dpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrak
    faqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlt
    iagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyna
    lreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfygrafkgvsgg
    nggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqgnygyqrlwndk
    tktpylyhaqnglfvtyddaesfkykakyikqqqlggvmfwhlgqdnrngdllaaldryf
    naadyddsqldmgtglrytgvgpgnlpimtapayvpgttyaqgalvsyqgyvwqtkwgyi
    tsapgsdsawlkvgrva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w1vB (B:)
    mstrkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlec
    awdpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasr
    akfaqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyq
    ltiagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfy
    nalreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfygrafkgvs
    ggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqgnygyqrlwn
    dktktpylyhaqnglfvtyddaesfkykakyikqqqlggvmfwhlgqdnrngdllaaldr
    yfnaadyddsqldmgtglrytgvgpgnlpimtapayvpgttyaqgalvsyqgyvwqtkwg
    yitsapgsdsawlkvgrva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1vB (B:)
    trkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecaw
    dpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrak
    faqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlt
    iagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyna
    lreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfygrafkgvsgg
    nggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqgnygyqrlwndk
    tktpylyhaqnglfvtyddaesfkykakyikqqqlggvmfwhlgqdnrngdllaaldryf
    naadyddsqldmgtglrytgvgpgnlpimtapayvpgttyaqgalvsyqgyvwqtkwgyi
    tsapgsdsawlkvgrva