PDB entry 1w1u

View 1w1u on RCSB PDB site
Description: inactive urocanase-sa cocrystallized with urocanate
Class: hydrolase
Keywords: hydrolase, urocanase, imidazolonepropionate, lyase, histidine metabolism
Deposited on 2004-06-24, released 2004-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.179
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Urocanate hydratase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W1U
      • conflict (5)
      • engineered mutation (197)
      • engineered mutation (454)
    • Uniprot P25080
    Domains in SCOPe 2.07: d1w1ua_
  • Chain 'B':
    Compound: Urocanate hydratase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W1U
      • conflict (5)
      • engineered mutation (197)
      • engineered mutation (454)
    • Uniprot P25080
    Domains in SCOPe 2.07: d1w1ub_
  • Heterogens: NAD, URO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w1uA (A:)
    mtdnnnyrdveiraprgnkltakswlteaplrmlmnnldpqvaenpkelvvyggigraar
    nwecydkivetltrleddetllvqsgkpvgvfkthsnaprvliansnlvphwanwehfne
    ldakglamygqmtagswiyigsqgivqgtyetfveagrqhyggslkgkwvltaglggmgg
    aqplaatlagacslniesqqsridfrletryvdeqatdlddalvriakytaegkaisial
    hgnaaeilpelvkrgvrpdmvtdqtsahdplngylpagwtweqyrdraqtepaavvkaak
    qsmavhvqamldfqkqgvptfdygnnirqmakeegvanafdfpgfvpayirplfcrgvgp
    frwaalsgeaediyktdakvkelipddahlhrwldmarerisfqglparicwvglglrak
    lglafnemvrsgelsapvvigrdhldsgsvsspnaeteamrdgsdavsdwpllnallnta
    ggatwvslhhgggvgmgfsqhsgmvivcdgtdeaaeriarvltndpgtgvmrhadagydi
    aidcakeqgldlpmitg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1uA (A:)
    nnyrdveiraprgnkltakswlteaplrmlmnnldpqvaenpkelvvyggigraarnwec
    ydkivetltrleddetllvqsgkpvgvfkthsnaprvliansnlvphwanwehfneldak
    glamygqmtagswiyigsqgivqgtyetfveagrqhyggslkgkwvltaglggmggaqpl
    aatlagacslniesqqsridfrletryvdeqatdlddalvriakytaegkaisialhgna
    aeilpelvkrgvrpdmvtdqtsahdplngylpagwtweqyrdraqtepaavvkaakqsma
    vhvqamldfqkqgvptfdygnnirqmakeegvanafdfpgfvpayirplfcrgvgpfrwa
    alsgeaediyktdakvkelipddahlhrwldmarerisfqglparicwvglglraklgla
    fnemvrsgelsapvvigrdhldsgsvsspnaeteamrdgsdavsdwpllnallntaggat
    wvslhhgggvgmgfsqhsgmvivcdgtdeaaeriarvltndpgtgvmrhadagydiaidc
    akeqgldlpmi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w1uB (B:)
    mtdnnnyrdveiraprgnkltakswlteaplrmlmnnldpqvaenpkelvvyggigraar
    nwecydkivetltrleddetllvqsgkpvgvfkthsnaprvliansnlvphwanwehfne
    ldakglamygqmtagswiyigsqgivqgtyetfveagrqhyggslkgkwvltaglggmgg
    aqplaatlagacslniesqqsridfrletryvdeqatdlddalvriakytaegkaisial
    hgnaaeilpelvkrgvrpdmvtdqtsahdplngylpagwtweqyrdraqtepaavvkaak
    qsmavhvqamldfqkqgvptfdygnnirqmakeegvanafdfpgfvpayirplfcrgvgp
    frwaalsgeaediyktdakvkelipddahlhrwldmarerisfqglparicwvglglrak
    lglafnemvrsgelsapvvigrdhldsgsvsspnaeteamrdgsdavsdwpllnallnta
    ggatwvslhhgggvgmgfsqhsgmvivcdgtdeaaeriarvltndpgtgvmrhadagydi
    aidcakeqgldlpmitg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1uB (B:)
    nnyrdveiraprgnkltakswlteaplrmlmnnldpqvaenpkelvvyggigraarnwec
    ydkivetltrleddetllvqsgkpvgvfkthsnaprvliansnlvphwanwehfneldak
    glamygqmtagswiyigsqgivqgtyetfveagrqhyggslkgkwvltaglggmggaqpl
    aatlagacslniesqqsridfrletryvdeqatdlddalvriakytaegkaisialhgna
    aeilpelvkrgvrpdmvtdqtsahdplngylpagwtweqyrdraqtepaavvkaakqsma
    vhvqamldfqkqgvptfdygnnirqmakeegvanafdfpgfvpayirplfcrgvgpfrwa
    alsgeaediyktdakvkelipddahlhrwldmarerisfqglparicwvglglraklgla
    fnemvrsgelsapvvigrdhldsgsvsspnaeteamrdgsdavsdwpllnallntaggat
    wvslhhgggvgmgfsqhsgmvivcdgtdeaaeriarvltndpgtgvmrhadagydiaidc
    akeqgldlpmi