PDB entry 1w1t

View 1w1t on RCSB PDB site
Description: Crystal structure of S. marcescens chitinase B in complex with the cyclic dipeptide inhibitor cyclo-(His-L-Pro) at 1.9 A resolution
Class: hydrolase
Keywords: hydrolase, glycoside hydrolase, chitinase, structure-based inhibitor design, cyclic dipeptide
Deposited on 2004-06-24, released 2005-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase b
    Species: Serratia marcescens [TaxId:615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w1ta1, d1w1ta2, d1w1ta3
  • Chain 'B':
    Compound: chitinase b
    Species: Serratia marcescens [TaxId:615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w1tb1, d1w1tb2, d1w1tb3
  • Heterogens: GOL, SO4, CHQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w1tA (A:)
    mstrkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlec
    awdpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasr
    akfaqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyq
    ltiagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfy
    nalreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfygrafkgvs
    ggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqgnygyqrlwn
    dktktpylyhaqnglfvtyddaesfkykakyikqqqlggvmfwhlgqdnrngdllaaldr
    yfnaadyddsqldmgtglrytgvgpgnlpimtapayvpgttyaqgalvsyqgyvwqtkwg
    yitsapgsdsawlkvgrva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1tA (A:)
    trkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecaw
    dpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrak
    faqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlt
    iagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyna
    lreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfygrafkgvsgg
    nggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqgnygyqrlwndk
    tktpylyhaqnglfvtyddaesfkykakyikqqqlggvmfwhlgqdnrngdllaaldryf
    naadyddsqldmgtglrytgvgpgnlpimtapayvpgttyaqgalvsyqgyvwqtkwgyi
    tsapgsdsawlkvgrva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w1tB (B:)
    mstrkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlec
    awdpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasr
    akfaqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyq
    ltiagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfy
    nalreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfygrafkgvs
    ggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqgnygyqrlwn
    dktktpylyhaqnglfvtyddaesfkykakyikqqqlggvmfwhlgqdnrngdllaaldr
    yfnaadyddsqldmgtglrytgvgpgnlpimtapayvpgttyaqgalvsyqgyvwqtkwg
    yitsapgsdsawlkvgrva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1tB (B:)
    trkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecaw
    dpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrak
    faqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlt
    iagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyna
    lreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfygrafkgvsgg
    nggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqgnygyqrlwndk
    tktpylyhaqnglfvtyddaesfkykakyikqqqlggvmfwhlgqdnrngdllaaldryf
    naadyddsqldmgtglrytgvgpgnlpimtapayvpgttyaqgalvsyqgyvwqtkwgyi
    tsapgsdsawlkvgrva