PDB entry 1w1s

View 1w1s on RCSB PDB site
Description: plant cytokinin dehydrogenase in complex with benzylaminopurine
Deposited on 2004-06-23, released 2004-08-26
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-26, with a file datestamp of 2004-08-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19836
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w1sA (A:)
    mavvyylllagliacshalaagtpalgddrgrpwpaslaalaldgklrtdsnataaastd
    fgnitsalpaavlypsstgdlvallsaanstpgwpytiafrgrghslmgqafapggvvvn
    maslgdaaapprinvsadgryvdaggeqvwidvlraslargvaprswtdylyltvggtls
    nagisgqafrhgpqisnvlemdvitghgemvtcskqlnadlfdavlgglgqfgvitrari
    avepapararwvrfvytdfaafsadqerltaprpggggasfgpmsyvegsvfvnqslatd
    lantgfftdadvarivalagernattvysieatlnydnataaaaavdqelasvlgtlsyv
    egfafqrdvayaafldrvhgeevalnklglwrvphpwlnmfvprsriadfdrgvfkgilq
    gtdivgplivyplnksmwddgmsaatpsedvfyavsllfssvapndlarlqeqnrrilrf
    cdlagiqyktylarhtdrsdwvrhfgaakwnrfvemknkydpkrllspgqdifn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1sA (A:)
    alaldgklrtdsnataaastdfgnitsalpaavlypsstgdlvallsaanstpgwpytia
    frgrghslmgqafapggvvvnmaslgdaaapprinvsadgryvdaggeqvwidvlrasla
    rgvaprswtdylyltvggtlsnagisgqafrhgpqisnvlemdvitghgemvtcskqlna
    dlfdavlgglgqfgvitrariavepapararwvrfvytdfaafsadqerltaprsfgpms
    yvegsvfvnqslatdlantgfftdadvarivalagernattvysieatlnyaavdqelas
    vlgtlsyvegfafqrdvayaafldrvhgeevalnklglwrvphpwlnmfvprsriadfdr
    gvfkgilqgtdivgplivyplnksmwddgmsaatpsedvfyavsllfssndlarlqeqnr
    rilrfcdlagiqyktylarhtdrsdwvrhfgaakwnrfvemknkydpkrllspgqdifn