PDB entry 1w1r

View 1w1r on RCSB PDB site
Description: plant cytokinin dehydrogenase in complex with trans-zeatin
Class: oxidoreductase
Keywords: oxidoreductase, flavoprotein, fad, signal, glycoprotein
Deposited on 2004-06-23, released 2004-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.206
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytokinin dehydrogenase 1
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9T0N8 (Start-533)
      • conflict (78)
      • conflict (253)
    Domains in SCOPe 2.07: d1w1ra1, d1w1ra2
  • Heterogens: FAD, ZEA, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w1rA (A:)
    mavvyylllagliacshalaagtpalgddrgrpwpaslaalaldgklrtdsnataaastd
    fgnitsalpaavlypsstgdlvallsaanstpgwpytiafrgrghslmgqafapggvvvn
    maslgdaaapprinvsadgryvdaggeqvwidvlraslargvaprswtdylyltvggtls
    nagisgqafrhgpqisnvlemdvitghgemvtcskqlnadlfdavlgglgqfgvitrari
    avepapararwvrfvytdfaafsadqerltaprpggggasfgpmsyvegsvfvnqslatd
    lantgfftdadvarivalagernattvysieatlnydnataaaaavdqelasvlgtlsyv
    egfafqrdvayaafldrvhgeevalnklglwrvphpwlnmfvprsriadfdrgvfkgilq
    gtdivgplivyplnksmwddgmsaatpsedvfyavsllfssvapndlarlqeqnrrilrf
    cdlagiqyktylarhtdrsdwvrhfgaakwnrfvemknkydpkrllspgqdifn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1rA (A:)
    alaldgklrtdsnataaastdfgnitsalpaavlypsstgdlvallsaanstpgwpytia
    frgrghslmgqafapggvvvnmaslgdaaapprinvsadgryvdaggeqvwidvlrasla
    rgvaprswtdylyltvggtlsnagisgqafrhgpqisnvlemdvitghgemvtcskqlna
    dlfdavlgglgqfgvitrariavepapararwvrfvytdfaafsadqerltaprsfgpms
    yvegsvfvnqslatdlantgfftdadvarivalagernattvysieatlnyaavdqelas
    vlgtlsyvegfafqrdvayaafldrvhgeevalnklglwrvphpwlnmfvprsriadfdr
    gvfkgilqgtdivgplivyplnksmwddgmsaatpsedvfyavsllfssndlarlqeqnr
    rilrfcdlagiqyktylarhtdrsdwvrhfgaakwnrfvemknkydpkrllspgqdifn