PDB entry 1w1n

View 1w1n on RCSB PDB site
Description: the solution structure of the fatc domain of the protein kinase tor1 from yeast
Deposited on 2004-06-23, released 2005-03-16
The last revision was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol 3-kinase tor1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1w1nA (A:)
    neldvpeqvdkliqqatsierlcqhyigwcpfw