PDB entry 1w1m

View 1w1m on RCSB PDB site
Description: structure of the octameric flavoenzyme vanillyl-alcohol oxidase: glu502gly mutant
Class: oxidoreductase
Keywords: flavoenzyme, oxidoreductase, catalysis, fad
Deposited on 2004-06-22, released 2004-07-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.221
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vanillyl-alcohol oxidase
    Species: Penicillium simplicissimum [TaxId:69488]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56216 (Start-559)
      • engineered mutation (501)
    Domains in SCOPe 2.07: d1w1ma1, d1w1ma2
  • Chain 'B':
    Compound: vanillyl-alcohol oxidase
    Species: Penicillium simplicissimum [TaxId:69488]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56216 (Start-559)
      • engineered mutation (501)
    Domains in SCOPe 2.07: d1w1mb1, d1w1mb2
  • Heterogens: FAD, EUG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w1mA (A:)
    msktqefrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdp
    hhvmdqdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvv
    ldmgknmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgna
    vergvgytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiah
    lfpygfgpyidglfsqsnmgivtkigiwlmpnprgyqsylitlpkdgdlkqavdiirplr
    lgmalqnvptirhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygp
    epirrvlwetikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpng
    ahlffspiakvsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliq
    krkvqwlmrtliddcaangwggyrthlafmdqimetynwnnssflrfnevlknavdpngi
    iapgksgvwpsqyshvtwkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1mA (A:)
    efrpltlppklslsdfnefiqdiirivgsenvevisvdgsymkpththdphhvmdqdyfl
    asaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgknmnrv
    levnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergvgytpy
    gdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpygfgpyi
    dglfsqsnmgivtkigiwlmpnprgyqsylitlpkdgdlkqavdiirplrlgmalqnvpt
    irhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygpepirrvlwet
    ikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpngahlffspiak
    vsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliqkrkvqwlmrt
    liddcaangwggyrthlafmdqimetynwnnssflrfnevlknavdpngiiapgksgvwp
    sqyshvtwkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w1mB (B:)
    msktqefrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdp
    hhvmdqdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvv
    ldmgknmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgna
    vergvgytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiah
    lfpygfgpyidglfsqsnmgivtkigiwlmpnprgyqsylitlpkdgdlkqavdiirplr
    lgmalqnvptirhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygp
    epirrvlwetikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpng
    ahlffspiakvsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliq
    krkvqwlmrtliddcaangwggyrthlafmdqimetynwnnssflrfnevlknavdpngi
    iapgksgvwpsqyshvtwkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1mB (B:)
    efrpltlppklslsdfnefiqdiirivgsenvevisvdgsymkpththdphhvmdqdyfl
    asaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgknmnrv
    levnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergvgytpy
    gdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpygfgpyi
    dglfsqsnmgivtkigiwlmpnprgyqsylitlpkdgdlkqavdiirplrlgmalqnvpt
    irhilldaavlgdkrsyssrteplsdeeldkiakqlnlgrwnfygalygpepirrvlwet
    ikdafsaipgvkfyfpedtpensvlrvrdktmqgiptydelkwidwlpngahlffspiak
    vsgedammqyavtkkrcqeagldfigtftvgmremhhivcivfnkkdliqkrkvqwlmrt
    liddcaangwggyrthlafmdqimetynwnnssflrfnevlknavdpngiiapgksgvwp
    sqyshvtwkl