PDB entry 1w1i

View 1w1i on RCSB PDB site
Description: crystal structure of dipeptidyl peptidase IV (dppiv or cd26) in complex with adenosine deaminase
Class: hydrolase
Keywords: hydrolase, hydrolase/complex, dipetidyl peptidase IV, dppiv, cd26, alpha/beta-hydrolase fold, beta-propeller fold, protein-protein complex, adenosine deaminase, ada, serine protease, aminopeptidase
Deposited on 2004-06-22, released 2004-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.03 Å
R-factor: 0.224
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptidyl peptidase IV
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w1ia1, d1w1ia2
  • Chain 'B':
    Compound: dipeptidyl peptidase IV
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w1ib1, d1w1ib2
  • Chain 'C':
    Compound: dipeptidyl peptidase IV
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w1ic1, d1w1ic2
  • Chain 'D':
    Compound: dipeptidyl peptidase IV
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w1id1, d1w1id2
  • Chain 'E':
    Compound: adenosine deaminase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56658
      • conflict see remark 9 (7)
      • conflict see remark 9 (31-32)
      • conflict (46)
      • conflict see remark 9 (56)
      • conflict see remark 9 (59)
      • conflict see remark 9 (76)
      • conflict see remark 9 (78)
      • variant (198)
      • variant (245)
      • conflict see remark 9 (260)
      • conflict see remark 9 (278)
      • conflict see remark 9 (280)
      • conflict see remark 9 (312-313)
      • variant (351)
    Domains in SCOPe 2.07: d1w1ie_
  • Chain 'F':
    Compound: adenosine deaminase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56658
      • conflict see remark 9 (7)
      • conflict see remark 9 (31-32)
      • conflict (46)
      • conflict see remark 9 (56)
      • conflict see remark 9 (59)
      • conflict see remark 9 (76)
      • conflict see remark 9 (78)
      • variant (198)
      • variant (245)
      • conflict see remark 9 (260)
      • conflict see remark 9 (278)
      • conflict see remark 9 (280)
      • conflict see remark 9 (312-313)
      • variant (351)
    Domains in SCOPe 2.07: d1w1if_
  • Chain 'G':
    Compound: adenosine deaminase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56658
      • conflict see remark 9 (7)
      • conflict see remark 9 (31-32)
      • conflict (46)
      • conflict see remark 9 (56)
      • conflict see remark 9 (59)
      • conflict see remark 9 (76)
      • conflict see remark 9 (78)
      • variant (198)
      • variant (245)
      • conflict see remark 9 (260)
      • conflict see remark 9 (278)
      • conflict see remark 9 (280)
      • conflict see remark 9 (312-313)
      • variant (351)
    Domains in SCOPe 2.07: d1w1ig_
  • Chain 'H':
    Compound: adenosine deaminase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56658
      • conflict see remark 9 (7)
      • conflict see remark 9 (31-32)
      • conflict (46)
      • conflict see remark 9 (56)
      • conflict see remark 9 (59)
      • conflict see remark 9 (76)
      • conflict see remark 9 (78)
      • variant (198)
      • variant (245)
      • conflict see remark 9 (260)
      • conflict see remark 9 (278)
      • conflict see remark 9 (280)
      • conflict see remark 9 (312-313)
      • variant (351)
    Domains in SCOPe 2.07: d1w1ih_
  • Heterogens: NAG, NDG, ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w1iA (A:)
    srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
    ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
    pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
    vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
    clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
    kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
    vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfii
    lnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsm
    vlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshf
    ikqcfslp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w1iB (B:)
    srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
    ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
    pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
    vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
    clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
    kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
    vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfii
    lnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsm
    vlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshf
    ikqcfslp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w1iC (C:)
    srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
    ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
    pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
    vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
    clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
    kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
    vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfii
    lnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsm
    vlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshf
    ikqcfslp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w1iD (D:)
    srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
    ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
    pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
    vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
    clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
    kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
    vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfii
    lnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsm
    vlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshf
    ikqcfslp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1w1iE (E:)
    maqtpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeellniigmdkpltlpd
    flakfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqa
    egdltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvai
    dlagdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgy
    htledttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplif
    kstldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayrmpspa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1iE (E:)
    tpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeellniigmdkpltlpdfla
    kfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqaegd
    ltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaidla
    gdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyhtl
    edttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifkst
    ldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayrmps
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1w1iF (F:)
    maqtpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeellniigmdkpltlpd
    flakfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqa
    egdltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvai
    dlagdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgy
    htledttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplif
    kstldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayrmpspa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1iF (F:)
    tpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeellniigmdkpltlpdfla
    kfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqaegd
    ltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaidla
    gdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyhtl
    edttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifkst
    ldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayrmps
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1w1iG (G:)
    maqtpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeellniigmdkpltlpd
    flakfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqa
    egdltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvai
    dlagdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgy
    htledttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplif
    kstldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayrmpspa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1iG (G:)
    tpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeellniigmdkpltlpdfla
    kfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqaegd
    ltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaidla
    gdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyhtl
    edttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifkst
    ldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayrmps
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1w1iH (H:)
    maqtpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeellniigmdkpltlpd
    flakfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqa
    egdltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvai
    dlagdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgy
    htledttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplif
    kstldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayrmpspa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1iH (H:)
    tpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeellniigmdkpltlpdfla
    kfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqaegd
    ltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaidla
    gdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyhtl
    edttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifkst
    ldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayrmps