PDB entry 1w1g

View 1w1g on RCSB PDB site
Description: crystal structure of the pdk1 pleckstrin homology (ph) domain bound to dic4-phosphatidylinositol (3,4,5)-trisphosphate
Deposited on 2004-06-21, released 2004-11-19
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-19, with a file datestamp of 2004-11-19.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.18315
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1w1ga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w1gA (A:)
    gplgsnieqyihdldsnsfeldlqfsedekrlllekqaggnpwhqfvennlilkmgpvdk
    rkglfarrrqllltegphlyyvdpvnkvlkgeipwsqelrpeaknfktffvhtpnrtyyl
    mdpsgnahkwcrkiqevwrqryqshpdaavq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1gA (A:)
    plgsnieqyihdldsnsfeldlqfsedekrlllekqaggnpwhqfvennlilkmgpvdkr
    kglfarrrqllltegphlyyvdpvnkvlkgeipwsqelrpeaknfktffvhtpnrtyylm
    dpsgnahkwcrkiqevwrqryqsh