PDB entry 1w1g

View 1w1g on RCSB PDB site
Description: crystal structure of the pdk1 pleckstrin homology (ph) domain bound to dic4-phosphatidylinositol (3,4,5)-trisphosphate
Class: transferase
Keywords: transferase, pdk1, phosphoinositide dependent protein kinase 1, pkb, pleckstrin homology domain, inositol phosphate, phosphoinositide, signal transduction, pi3-kinase, pip3 serine/threonine protein kinase
Deposited on 2004-06-21, released 2004-11-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.183
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-phosphoinositide dependent protein kinase-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W1G (Start-2)
    • Uniprot O15530 (3-End)
    Domains in SCOPe 2.08: d1w1ga1, d1w1ga2
  • Heterogens: 4PT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w1gA (A:)
    gplgsnieqyihdldsnsfeldlqfsedekrlllekqaggnpwhqfvennlilkmgpvdk
    rkglfarrrqllltegphlyyvdpvnkvlkgeipwsqelrpeaknfktffvhtpnrtyyl
    mdpsgnahkwcrkiqevwrqryqshpdaavq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1gA (A:)
    plgsnieqyihdldsnsfeldlqfsedekrlllekqaggnpwhqfvennlilkmgpvdkr
    kglfarrrqllltegphlyyvdpvnkvlkgeipwsqelrpeaknfktffvhtpnrtyylm
    dpsgnahkwcrkiqevwrqryqsh