PDB entry 1w1f

View 1w1f on RCSB PDB site
Description: sh3 domain of human lyn tyrosine kinase
Class: sh3-domain
Keywords: sh3-domain, sh3 domain, tyrosine kinase, signal transduction, lyn
Deposited on 2004-06-21, released 2005-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein kinase lyn
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W1F
    • Uniprot P07948 (Start-64)
    Domains in SCOPe 2.07: d1w1fa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w1fA (A:)
    gspeeqgdivvalypydgihpddlsfkkgekmkvleehgewwkakslltkkegfipsnyv
    aklnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1fA (A:)
    qgdivvalypydgihpddlsfkkgekmkvleehgewwkakslltkkegfipsnyvaklnt