PDB entry 1w1d

View 1w1d on RCSB PDB site
Description: crystal structure of the pdk1 pleckstrin homology (ph) domain bound to inositol (1,3,4,5)-tetrakisphosphate
Class: transferase
Keywords: transferase, pdk1, phosphoinositide dependent protein kinase 1, pkb, pleckstrin homology domain, inositol phosphate, phosphoinositide, signal transduction, pi3-kinase, serine/threonine protein kinase
Deposited on 2004-06-21, released 2004-11-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.147
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 3-phosphoinositide dependent protein kinase-1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 1W1D (Start-2)
  • Uniprot O15530 (3-End)
  Domains in SCOPe 2.05: d1w1da_
• Heterogens: GOL, AU, 4IP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1w1dA (A:)
  gplgsnieqyihdldsnsfeldlqfsedekrlllekqaggnpwhqfvennlilkmgpvdk
  rkglfarrrqllltegphlyyvdpvnkvlkgeipwsqelrpeaknfktffvhtpnrtyyl
  mdpsgnahkwcrkiqevwrqryqshpdaavq
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1w1dA (A:)
  plgsnieqyihdldsnsfeldlqfsedekrlllekqaggnpwhqfvennlilkmgpvdkr
  kglfarrrqllltegphlyyvdpvnkvlkgeipwsqelrpeaknfktffvhtpnrtyylm
  dpsgnahkwcrkiqevwrqryqsh