PDB entry 1w1a

View 1w1a on RCSB PDB site
Description: structure of bacillus subtilis pdaa in complex with nag, a family 4 carbohydrate esterase.
Class: hydrolase
Keywords: family 4 carbohydrate esterase,deacetylase,peptidoglycan, nodb homology domain, hydrolase, sporulation
Deposited on 2004-06-18, released 2005-01-10
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.202
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Probable polysaccharide deacetylase pdaA
    Species: Bacillus subtilis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1w1a11
  • Chain '2':
    Compound: Probable polysaccharide deacetylase pdaA
    Species: Bacillus subtilis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1w1a21
  • Heterogens: NDG, CD, GOL, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1w1a1 (1:)
    gplgsvllaggaaqaeavpnepinwgfkrsvnhqppdagkqlnsliekydafylgntkek
    tiyltfdngyengytpkvldvlkkhrvtgtffvtghfvkdqpqlikrmsdeghiignhsf
    hhpdlttktadqiqdeldsvneevykitgkqdnlylrpprgvfseyvlketkrlgyqtvf
    wsvafvdwkinnqkgkkyaydhmikqahpgaiyllhtvsrdnaealddaitdlkkqgytf
    ksiddlmfekemrlpsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1a1 (1:)
    vpnepinwgfkrsvnhqppdagkqlnsliekydafylgntkektiyltfdngyengytpk
    vldvlkkhrvtgtffvtghfvkdqpqlikrmsdeghiignhsfhhpdlttktadqiqdel
    dsvneevykitgkqdnlylrpprgvfseyvlketkrlgyqtvfwsvafvdwkinnqkgkk
    yaydhmikqahpgaiyllhtvsrdnaealddaitdlkkqgytfksiddlmfekemr
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >1w1a2 (2:)
    gplgsvllaggaaqaeavpnepinwgfkrsvnhqppdagkqlnsliekydafylgntkek
    tiyltfdngyengytpkvldvlkkhrvtgtffvtghfvkdqpqlikrmsdeghiignhsf
    hhpdlttktadqiqdeldsvneevykitgkqdnlylrpprgvfseyvlketkrlgyqtvf
    wsvafvdwkinnqkgkkyaydhmikqahpgaiyllhtvsrdnaealddaitdlkkqgytf
    ksiddlmfekemrlpsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1a2 (2:)
    vpnepinwgfkrsvnhqppdagkqlnsliekydafylgntkektiyltfdngyengytpk
    vldvlkkhrvtgtffvtghfvkdqpqlikrmsdeghiignhsfhhpdlttktadqiqdel
    dsvneevykitgkqdnlylrpprgvfseyvlketkrlgyqtvfwsvafvdwkinnqkgkk
    yaydhmikqahpgaiyllhtvsrdnaealddaitdlkkqgytfksiddlmfekemr