PDB entry 1w19

View 1w19 on RCSB PDB site
Description: lumazine synthase from mycobacterium tuberculosis bound to 3-(1,3,7- trihydro-9-d-ribityl-2,6,8-purinetrione-7-yl)propane 1-phosphate
Deposited on 2004-06-18, released 2005-03-02
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.151
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACY, DTU, T1P, K, T2P, DTV, T5P, T4P, D1D, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1w19A (A:)
    mkggagvpdlpsldasgvrlaivasswhgkicdalldgarkvaagcglddptvvrvlgai
    eipvvaqelarnhdavvalgvvirgqtphfdyvcdavtqgltrvsldsstpiangvlttn
    teeqaldraglptsaedkgaqatvaalataltlrelrahs
    

    Sequence, based on observed residues (ATOM records):
    >1w19A (A:)
    dasgvrlaivasswhgkicdalldgarkvaagcglddptvvrvlgaieipvvaqelarnh
    davvalgvvirgqtphfdyvcdavtqgltrvsldsstpiangvlttnteeqaldraglpt
    saedkgaqatvaalataltlrelrahs
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1w19B (B:)
    mkggagvpdlpsldasgvrlaivasswhgkicdalldgarkvaagcglddptvvrvlgai
    eipvvaqelarnhdavvalgvvirgqtphfdyvcdavtqgltrvsldsstpiangvlttn
    teeqaldraglptsaedkgaqatvaalataltlrelrahs
    

    Sequence, based on observed residues (ATOM records):
    >1w19B (B:)
    dasgvrlaivasswhgkicdalldgarkvaagcglddptvvrvlgaieipvvaqelarnh
    davvalgvvirgqtphfdyvcdavtqgltrvsldsstpiangvlttnteeqaldraglpt
    saedkgaqatvaalataltlrelrahs
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1w19C (C:)
    mkggagvpdlpsldasgvrlaivasswhgkicdalldgarkvaagcglddptvvrvlgai
    eipvvaqelarnhdavvalgvvirgqtphfdyvcdavtqgltrvsldsstpiangvlttn
    teeqaldraglptsaedkgaqatvaalataltlrelrahs
    

    Sequence, based on observed residues (ATOM records):
    >1w19C (C:)
    asgvrlaivasswhgkicdalldgarkvaagcglddptvvrvlgaieipvvaqelarnhd
    avvalgvvirgqtphfdyvcdavtqgltrvsldsstpiangvlttnteeqaldraglpts
    aedkgaqatvaalataltlrelrahs
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1w19D (D:)
    mkggagvpdlpsldasgvrlaivasswhgkicdalldgarkvaagcglddptvvrvlgai
    eipvvaqelarnhdavvalgvvirgqtphfdyvcdavtqgltrvsldsstpiangvlttn
    teeqaldraglptsaedkgaqatvaalataltlrelrahs
    

    Sequence, based on observed residues (ATOM records):
    >1w19D (D:)
    dasgvrlaivasswhgkicdalldgarkvaagcglddptvvrvlgaieipvvaqelarnh
    davvalgvvirgqtphfdyvcdavtqgltrvsldsstpiangvlttnteeqaldraglpt
    saedkgaqatvaalataltlrelrahs
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >1w19E (E:)
    mkggagvpdlpsldasgvrlaivasswhgkicdalldgarkvaagcglddptvvrvlgai
    eipvvaqelarnhdavvalgvvirgqtphfdyvcdavtqgltrvsldsstpiangvlttn
    teeqaldraglptsaedkgaqatvaalataltlrelrahs
    

    Sequence, based on observed residues (ATOM records):
    >1w19E (E:)
    asgvrlaivasswhgkicdalldgarkvaagcglddptvvrvlgaieipvvaqelarnhd
    avvalgvvirgqtphfdyvcdavtqgltrvsldsstpiangvlttnteeqaldraglpts
    aedkgaqatvaalataltlrelrahs