PDB entry 1w18

View 1w18 on RCSB PDB site
Description: crystal structure of levansucrase from gluconacetobacter diazotrophicus
Deposited on 2004-06-18, released 2005-05-11
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Levansucrase
    Species: GLUCONACETOBACTER DIAZOTROPHICUS [TaxId:33996]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Levansucrase
    Species: GLUCONACETOBACTER DIAZOTROPHICUS [TaxId:33996]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1w18A (A:)
    agvpgfplpsihtqqaydpqsdftarwtradalqikahsdatvaagqnslpaqltmpnip
    adfpvinpdvwvwdtwtlidkhadqfsyngwevifcltadpnagygfddrhvharigffy
    rragipasrrpvnggwtygghlfpdgasaqvyagqtytnqaewsgssrlmqihgntvsvf
    ytdvafnrdanannitppqaiitqtlgrihadfnhvwftgftahtpllqpdgvlyqngaq
    neffnfrdpftfedpkhpgvnymvfegntagqrgvancteadlgfrpndpnaetlqevld
    sgayyqkaniglaiatdstlskwkflsplisancvndqterpqvylhngkyyiftishrt
    tfaagvdgpdgvygfvgdgirsdfqpmnygsgltmgnptdlntaagtdfdpspdqnpraf
    qsyshyvmpgglvesfidtvenrrggtlaptvrvriaqnasavdlrygngglggygdipa
    nradvniagfiqd
    

    Sequence, based on observed residues (ATOM records):
    >1w18A (A:)
    gvpgfplpsihtqqaydpqsdftarwtradalqikahsdatvaagqnslpaqltmpnipa
    dfpvinpdvwvwdtwtlidkhadqfsyngwevifcltadpnagygfddrhvharigffyr
    ragipasrrpvnggwtygghlfpdgasaqvyagqtytnqaewsgssrlmqihgntvsvfy
    tdvafnrdanannitppqaiitqtlgrihadfnhvwftgftahtpllqpdgvlyqngaqn
    effnfrdpftfedpkhpgvnymvfegntagqrgvancteadlgfrpndpnaetlqevlds
    gayyqkaniglaiatdstlskwkflsplisancvndqterpqvylhngkyyiftishrtt
    faagvdgpdgvygfvgdgirsdfqpmnygsgltmgnptdlntaagtdfdpspdqnprafq
    syshyvmpgglvesfidtvenrrggtlaptvrvriaqnasavdlrygngglggygdipan
    radvniagfiqd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1w18B (B:)
    agvpgfplpsihtqqaydpqsdftarwtradalqikahsdatvaagqnslpaqltmpnip
    adfpvinpdvwvwdtwtlidkhadqfsyngwevifcltadpnagygfddrhvharigffy
    rragipasrrpvnggwtygghlfpdgasaqvyagqtytnqaewsgssrlmqihgntvsvf
    ytdvafnrdanannitppqaiitqtlgrihadfnhvwftgftahtpllqpdgvlyqngaq
    neffnfrdpftfedpkhpgvnymvfegntagqrgvancteadlgfrpndpnaetlqevld
    sgayyqkaniglaiatdstlskwkflsplisancvndqterpqvylhngkyyiftishrt
    tfaagvdgpdgvygfvgdgirsdfqpmnygsgltmgnptdlntaagtdfdpspdqnpraf
    qsyshyvmpgglvesfidtvenrrggtlaptvrvriaqnasavdlrygngglggygdipa
    nradvniagfiqd