PDB entry 1w16

View 1w16 on RCSB PDB site
Description: rat synaptotagmin 4 c2b domain in the absence of calcium
Class: metal binding protein
Keywords: metal binding protein, synaptotagmin, endocytosis/exocytosis, neurotransmitter release, transmembrane
Deposited on 2004-06-16, released 2004-08-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.217
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Synaptotagmin IV
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W16
    • Uniprot P50232 (15-152)
    Domains in SCOPe 2.06: d1w16a_
  • Heterogens: NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w16A (A:)
    gspgisgggggipsgrgellvslcyqsttntltvvvlkarhlpksdvsglsdpyvkvnly
    hakkriskkkthvkkctpnavfnelfvfdipcesleeisveflvldsergsrnevigrlv
    lgataegsggghwkeicdfprrqiakwhmlcdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w16A (A:)
    rgellvslcyqsttntltvvvlkarhlpsdpyvkvnlyhakkriskkkthvavfnelfvf
    dipcesleeisveflvldsergsrnevigrlvlgataegsggghwkeicdfprrqiakwh
    mlcdg