PDB entry 1w16

View 1w16 on RCSB PDB site
Description: rat synaptotagmin 4 c2b domain in the absence of calcium
Deposited on 2004-06-16, released 2004-08-13
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-13, with a file datestamp of 2004-08-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21741
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1w16a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w16A (A:)
    gspgisgggggipsgrgellvslcyqsttntltvvvlkarhlpksdvsglsdpyvkvnly
    hakkriskkkthvkkctpnavfnelfvfdipcesleeisveflvldsergsrnevigrlv
    lgataegsggghwkeicdfprrqiakwhmlcdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w16A (A:)
    rgellvslcyqsttntltvvvlkarhlpsdpyvkvnlyhakkriskkkthvavfnelfvf
    dipcesleeisveflvldsergsrnevigrlvlgataegsggghwkeicdfprrqiakwh
    mlcdg