PDB entry 1w15

View 1w15 on RCSB PDB site
Description: rat synaptotagmin 4 c2b domain in the presence of calcium
Class: metal binding protein
Keywords: synaptotagmin, calcium, endocytosis/exocytosis, neurotransmitter release, transmembrane
Deposited on 2004-06-16, released 2004-08-13
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-15, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.20609
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Synaptotagmin IV
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1w15a_
  • Heterogens: CA, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w15A (A:)
    gspgisgggggipsgrgellvslcyqsttntltvvvlkarhlpksdvsglsdpyvkvnly
    hakkriskkkthvkkctpnavfnelfvfdipcesleeisveflvldsergsrnevigrlv
    lgataegsggghwkeicdfprrqiakwhmlcdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w15A (A:)
    rgellvslcyqsttntltvvvlkarhlplsdpyvkvnlyhakkriskkkthvkkctpnav
    fnelfvfdipcesleeisveflvldsergsrnevigrlvlgataegsggghwkeicdfpr
    rqiakwhmlcdg