PDB entry 1w10

View 1w10 on RCSB PDB site
Description: urokinase type plasminogen activator
Class: hydrolase
Keywords: urokinase, hydrolase, plasminogen activator
Deposited on 2004-06-15, released 2008-05-20
The last revision prior to the SCOP 1.75 freeze date was dated 2008-05-20, with a file datestamp of 2008-05-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'U':
    Compound: urokinase-type plasminogen activator
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00749 (0-246)
      • conflict (120)
    Domains in SCOP 1.75: d1w10u1
  • Heterogens: SO4, SJ1, HOH

PDB Chain Sequences:

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w10U (U:)
    iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
    lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
    slpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk
    mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
    irshtke