PDB entry 1w0t
View 1w0t on RCSB PDB site
Description: htrf1 DNA-binding domain in complex with telomeric DNA.
Class: DNA-binding protein
Keywords: telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein, chromosomal protein, phosphorylation, ADP-ribosylation
Deposited on
2004-06-11, released
2004-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated
2009-06-09, with a file datestamp of
2009-06-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.252
AEROSPACI score: 0.38
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: telomeric repeat binding factor 1
Species: HOMO SAPIENS, synthetic [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1w0ta_ - Chain 'B':
Compound: telomeric repeat binding factor 1
Species: HOMO SAPIENS, synthetic [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1w0tb_ - Chain 'C':
Compound: 5'-d(*cp*tp*gp*tp*tp*ap*gp*gp*gp*tp *tp*ap*gp*gp*gp*tp*tp*ap*g)-3'
- Chain 'D':
Compound: 5'-d(*tp*cp*tp*ap*ap*cp*cp*cp*tp*ap *ap*cp*cp*cp*tp*ap*ap*cp*a)-3'
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1w0tA (A:)
krqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkklk
Sequence, based on observed residues (ATOM records): (download)
>1w0tA (A:)
krqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkkl
- Chain 'B':
Sequence, based on SEQRES records: (download)
>1w0tB (B:)
krqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkklk
Sequence, based on observed residues (ATOM records): (download)
>1w0tB (B:)
krqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkkl
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.