PDB entry 1w0t

View 1w0t on RCSB PDB site
Description: htrf1 dna-binding domain in complex with telomeric dna.
Deposited on 2004-06-11, released 2004-12-22
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-22, with a file datestamp of 2004-12-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.252
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1w0ta_
  • Chain 'B':
    Domains in SCOP 1.71: d1w0tb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w0tA (A:)
    krqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w0tA (A:)
    krqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w0tB (B:)
    krqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w0tB (B:)
    krqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkkl