PDB entry 1w0r

View 1w0r on RCSB PDB site
Description: solution structure of dimeric form of properdin by x-ray solution scattering and analytical ultracentrifugation
Deposited on 2004-06-11, released 2005-07-06
The last revision was dated 2010-04-07, with a file datestamp of 2010-04-02.
Experiment type: SAXS
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: properdin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: properdin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1w0rA (A:)
    dpvlcftqyeessgkckgllgggvsvedcclntafayqkrsgglcqpcrsprwslwstwa
    pcsvtcsegsqlryrrcvgwngqcsgkvapgtlewqlqacedqqccpemggwsgwgpwep
    csvtcskgtrtrrracnhpapkcgghcpgqaqeseacdtqqvcpthgawatwgpwtpcsa
    schggphepketrsrkcsapepsqkppgkpcpglayeqrrctglppcpvaggwgpwgpvs
    pcpvtcglgqtmeqrtcnhpvpqhggpfcagdatrthicntavpcpvdgewdswgewspc
    irrnmksiscqeipgqqsrgrtcrgrkfdghrcagqqqdirhcysiqhcplkgswsewst
    wglcmppcgpnptrarqrlctpllpkypptvsmvegqgeknvtfwgrplprceelqgqkl
    vveekrpclhvpackdpeeeel
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1w0rB (B:)
    dpvlcftqyeessgkckgllgggvsvedcclntafayqkrsgglcqpcrsprwslwstwa
    pcsvtcsegsqlryrrcvgwngqcsgkvapgtlewqlqacedqqccpemggwsgwgpwep
    csvtcskgtrtrrracnhpapkcgghcpgqaqeseacdtqqvcpthgawatwgpwtpcsa
    schggphepketrsrkcsapepsqkppgkpcpglayeqrrctglppcpvaggwgpwgpvs
    pcpvtcglgqtmeqrtcnhpvpqhggpfcagdatrthicntavpcpvdgewdswgewspc
    irrnmksiscqeipgqqsrgrtcrgrkfdghrcagqqqdirhcysiqhcplkgswsewst
    wglcmppcgpnptrarqrlctpllpkypptvsmvegqgeknvtfwgrplprceelqgqkl
    vveekrpclhvpackdpeeeel