PDB entry 1w0p

View 1w0p on RCSB PDB site
Description: Vibrio cholerae sialidase with alpha-2,6-sialyllactose
Class: hydrolase
Keywords: hydrolase, vibrio cholerae, sialidase, neuraminidase, lectin
Deposited on 2004-06-09, released 2004-07-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sialidase
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1w0pa1, d1w0pa2, d1w0pa3
  • Heterogens: GOL, CA, TRS, SIA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w0pA (A:)
    mrfknvkktalmlamfgmatssnaalfdynatgdtefdspakqgwmqdntnngsgvltna
    dgmpawlvqgiggraqwtyslstnqhaqassfgwrmttemkvlsggmitnyyangtqrvl
    piisldssgnlvvefegqtgrtvlatgtaateyhkfelvflpgsnpsasfyfdgklirdn
    iqptaskqnmivwgngssntdgvaayrdikfeiqgdvifrgpdripsivassvtpgvvta
    faekrvgggdpgalsntndiitrtsrdggitwdtelnlteqinvsdefdfsdprpiydps
    sntvlvsyarwptdaaqngdrikpwmpngifysvydvasgnwqapidvtdqvkersfqia
    gwggselyrrntslnsqqdwqsnakirivdgaanqiqvadgsrkyvvtlsidesgglvan
    lngvsapiilqsehakvhsfhdyelqysalnhtttlfvdgqqittwagevsqenniqfgn
    adaqidgrlhvqkivltqqghnlvefdafylaqqtpevekdleklgwtkiktgntmslyg
    nasvnpgpghgitltrqqnisgsqngrliypaivldrfflnvmsiysddggsnwqtgstl
    pipfrwksssiletlepseadmvelqngdllltarldfnqivngvnysprqqflskdggi
    twslleannanvfsnistgtvdasitrfeqsdgshfllftnpqgnpagtngrqnlglwfs
    fdegvtwkgpiqlvngasaysdiyqldsenaivivetdnsnmrilrmpitllkqkltlsq
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w0pA (A:)
    alfdynatgdtefdspakqgwmqdntnngsgvltnadgmpawlvqgiggraqwtyslstn
    qhaqassfgwrmttemkvlsggmitnyyangtqrvlpiisldssgnlvvefegqtgrtvl
    atgtaateyhkfelvflpgsnpsasfyfdgklirdniqptaskqnmivwgngssntdgva
    ayrdikfeiqgdvifrgpdripsivassvtpgvvtafaekrvgggdpgalsntndiitrt
    srdggitwdtelnlteqinvsdefdfsdprpiydpssntvlvsyarwptdaaqngdrikp
    wmpngifysvydvasgnwqapidvtdqvkersfqiagwggselyrrntslnsqqdwqsna
    kirivdgaanqiqvadgsrkyvvtlsidesgglvanlngvsapiilqsehakvhsfhdye
    lqysalnhtttlfvdgqqittwagevsqenniqfgnadaqidgrlhvqkivltqqghnlv
    efdafylaqqtpevekdleklgwtkiktgntmslygnasvnpgpghgitltrqqnisgsq
    ngrliypaivldrfflnvmsiysddggsnwqtgstlpipfrwksssiletlepseadmve
    lqngdllltarldfnqivngvnysprqqflskdggitwslleannanvfsnistgtvdas
    itrfeqsdgshfllftnpqgnpagtngrqnlglwfsfdegvtwkgpiqlvngasaysdiy
    qldsenaivivetdnsnmrilrmpitllkqklt