PDB entry 1w0o

View 1w0o on RCSB PDB site
Description: Vibrio cholerae sialidase
Class: hydrolase
Keywords: vibrio cholerae, sialidase, glycosidase, hydrolase
Deposited on 2004-06-09, released 2004-07-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sialidase
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w0oa1, d1w0oa2, d1w0oa3
  • Heterogens: DAN, CA, SIA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w0oA (A:)
    mrfknvkktalmlamfgmatssnaalfdynatgdtefdspakqgwmqdntnngsgvltna
    dgmpawlvqgiggraqwtyslstnqhaqassfgwrmttemkvlsggmitnyyangtqrvl
    piisldssgnlvvefegqtgrtvlatgtaateyhkfelvflpgsnpsasfyfdgklirdn
    iqptaskqnmivwgngssntdgvaayrdikfeiqgdvifrgpdripsivassvtpgvvta
    faekrvgggdpgalsntndiitrtsrdggitwdtelnlteqinvsdefdfsdprpiydps
    sntvlvsyarwptdaaqngdrikpwmpngifysvydvasgnwqapidvtdqvkersfqia
    gwggselyrrntslnsqqdwqsnakirivdgaanqiqvadgsrkyvvtlsidesgglvan
    lngvsapiilqsehakvhsfhdyelqysalnhtttlfvdgqqittwagevsqenniqfgn
    adaqidgrlhvqkivltqqghnlvefdafylaqqtpevekdleklgwtkiktgntmslyg
    nasvnpgpghgitltrqqnisgsqngrliypaivldrfflnvmsiysddggsnwqtgstl
    pipfrwksssiletlepseadmvelqngdllltarldfnqivngvnysprqqflskdggi
    twslleannanvfsnistgtvdasitrfeqsdgshfllftnpqgnpagtngrqnlglwfs
    fdegvtwkgpiqlvngasaysdiyqldsenaivivetdnsnmrilrmpitllkqkltlsq
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w0oA (A:)
    alfdynatgdtefdspakqgwmqdntnngsgvltnadgmpawlvqgiggraqwtyslstn
    qhaqassfgwrmttemkvlsggmitnyyangtqrvlpiisldssgnlvvefegqtgrtvl
    atgtaateyhkfelvflpgsnpsasfyfdgklirdniqptaskqnmivwgngssntdgva
    ayrdikfeiqgdvifrgpdripsivassvtpgvvtafaekrvgggdpgalsntndiitrt
    srdggitwdtelnlteqinvsdefdfsdprpiydpssntvlvsyarwptdaaqngdrikp
    wmpngifysvydvasgnwqapidvtdqvkersfqiagwggselyrrntslnsqqdwqsna
    kirivdgaanqiqvadgsrkyvvtlsidesgglvanlngvsapiilqsehakvhsfhdye
    lqysalnhtttlfvdgqqittwagevsqenniqfgnadaqidgrlhvqkivltqqghnlv
    efdafylaqqtpevekdleklgwtkiktgntmslygnasvnpgpghgitltrqqnisgsq
    ngrliypaivldrfflnvmsiysddggsnwqtgstlpipfrwksssiletlepseadmve
    lqngdllltarldfnqivngvnysprqqflskdggitwslleannanvfsnistgtvdas
    itrfeqsdgshfllftnpqgnpagtngrqnlglwfsfdegvtwkgpiqlvngasaysdiy
    qldsenaivivetdnsnmrilrmpitllkqklt