PDB entry 1w0n

View 1w0n on RCSB PDB site
Description: Structure of uncomplexed Carbohydrate Binding Domain CBM36
Class: hydrolase
Keywords: hydrolase, carbohydrate-binding module, carbohydrate binding, xylan, cbm36, xylanase
Deposited on 2004-06-09, released 2004-10-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 0.8 Å
R-factor: N/A
AEROSPACI score: 1.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase d
    Species: Paenibacillus polymyxa [TaxId:1406]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w0na_
  • Heterogens: CA, MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w0nA (A:)
    wqftpntggntitkveaenmkiggtyagkisapfdgvalyanadyvsysqyfansthnis
    vrgassnagtakvdlviggvtvgsfnftgktptvqtlsnithatgdqeiklaltsddgtw
    dayvdfiefsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w0nA (A:)
    itkveaenmkiggtyagkisapfdgvalyanadyvsysqyfansthnisvrgassnagta
    kvdlviggvtvgsfnftgktptvqtlsnithatgdqeiklaltsddgtwdayvdfiefsl