PDB entry 1w0m

View 1w0m on RCSB PDB site
Description: Triosephosphate isomerase from Thermoproteus tenax
Class: isomerase
Keywords: isomerase, triosephosphate isomerase, glycolysis, gluconeogenesis
Deposited on 2004-06-08, released 2004-09-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Thermoproteus tenax [TaxId:2271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w0ma_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Thermoproteus tenax [TaxId:2271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w0mb_
  • Chain 'C':
    Compound: triosephosphate isomerase
    Species: Thermoproteus tenax [TaxId:2271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w0mc_
  • Chain 'D':
    Compound: triosephosphate isomerase
    Species: Thermoproteus tenax [TaxId:2271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w0md_
  • Chain 'E':
    Compound: triosephosphate isomerase
    Species: Thermoproteus tenax [TaxId:2271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w0me_
  • Chain 'F':
    Compound: triosephosphate isomerase
    Species: Thermoproteus tenax [TaxId:2271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w0mf_
  • Chain 'G':
    Compound: triosephosphate isomerase
    Species: Thermoproteus tenax [TaxId:2271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w0mg_
  • Chain 'H':
    Compound: triosephosphate isomerase
    Species: Thermoproteus tenax [TaxId:2271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w0mh_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w0mA (A:)
    mrlpiliinfkaygeaagkravelakaaeraarelgvnivvapnhlelglvsqsvdipvy
    aqgadveaggahtahvslenikeaggsgvilnhseaplklndlarlvakakslgldvvvc
    apdprtslaaaalgphavaveppeligtgravsrykpeaivetvglvsrhfpevsvitga
    giesgddvaaalrlgtrgvllasaavkakdpyakivelakplselr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w0mB (B:)
    mrlpiliinfkaygeaagkravelakaaeraarelgvnivvapnhlelglvsqsvdipvy
    aqgadveaggahtahvslenikeaggsgvilnhseaplklndlarlvakakslgldvvvc
    apdprtslaaaalgphavaveppeligtgravsrykpeaivetvglvsrhfpevsvitga
    giesgddvaaalrlgtrgvllasaavkakdpyakivelakplselr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w0mC (C:)
    mrlpiliinfkaygeaagkravelakaaeraarelgvnivvapnhlelglvsqsvdipvy
    aqgadveaggahtahvslenikeaggsgvilnhseaplklndlarlvakakslgldvvvc
    apdprtslaaaalgphavaveppeligtgravsrykpeaivetvglvsrhfpevsvitga
    giesgddvaaalrlgtrgvllasaavkakdpyakivelakplselr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w0mD (D:)
    mrlpiliinfkaygeaagkravelakaaeraarelgvnivvapnhlelglvsqsvdipvy
    aqgadveaggahtahvslenikeaggsgvilnhseaplklndlarlvakakslgldvvvc
    apdprtslaaaalgphavaveppeligtgravsrykpeaivetvglvsrhfpevsvitga
    giesgddvaaalrlgtrgvllasaavkakdpyakivelakplselr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w0mE (E:)
    mrlpiliinfkaygeaagkravelakaaeraarelgvnivvapnhlelglvsqsvdipvy
    aqgadveaggahtahvslenikeaggsgvilnhseaplklndlarlvakakslgldvvvc
    apdprtslaaaalgphavaveppeligtgravsrykpeaivetvglvsrhfpevsvitga
    giesgddvaaalrlgtrgvllasaavkakdpyakivelakplselr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1w0mF (F:)
    mrlpiliinfkaygeaagkravelakaaeraarelgvnivvapnhlelglvsqsvdipvy
    aqgadveaggahtahvslenikeaggsgvilnhseaplklndlarlvakakslgldvvvc
    apdprtslaaaalgphavaveppeligtgravsrykpeaivetvglvsrhfpevsvitga
    giesgddvaaalrlgtrgvllasaavkakdpyakivelakplselr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w0mF (F:)
    mrlpiliinfkaygeaagkravelakaaeraarelgvnivvapnhlelglvsqsvdipvy
    aqgadveaggahtahvslenikeaggsgvilnhseaplklndlarlvakakslgldvvvc
    apdprtslaaaalgphavaveppeligtgravsrykpeaivetvglvsrhfpevsvitga
    giesgddvaaalrlgtrgvllasaavkakdpyakivelakplsel
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1w0mG (G:)
    mrlpiliinfkaygeaagkravelakaaeraarelgvnivvapnhlelglvsqsvdipvy
    aqgadveaggahtahvslenikeaggsgvilnhseaplklndlarlvakakslgldvvvc
    apdprtslaaaalgphavaveppeligtgravsrykpeaivetvglvsrhfpevsvitga
    giesgddvaaalrlgtrgvllasaavkakdpyakivelakplselr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w0mG (G:)
    mrlpiliinfkaygeaagkravelakaaeraarelgvnivvapnhlelglvsqsvdipvy
    aqgadveaggahtahvslenikeaggsgvilnhseaplklndlarlvakakslgldvvvc
    apdprtslaaaalgphavaveppeligtgravsrykpeaivetvglvsrhfpevsvitga
    giesgddvaaalrlgtrgvllasaavkakdpyakivelakplse
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w0mH (H:)
    mrlpiliinfkaygeaagkravelakaaeraarelgvnivvapnhlelglvsqsvdipvy
    aqgadveaggahtahvslenikeaggsgvilnhseaplklndlarlvakakslgldvvvc
    apdprtslaaaalgphavaveppeligtgravsrykpeaivetvglvsrhfpevsvitga
    giesgddvaaalrlgtrgvllasaavkakdpyakivelakplselr