PDB entry 1w0h

View 1w0h on RCSB PDB site
Description: crystallographic structure of the nuclease domain of 3'hexo, a deddh family member, bound to ramp
Class: hydrolase
Keywords: nuclease domain, hydrolase, nuclease, exonuclease
Deposited on 2004-06-04, released 2004-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.17
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3'-5' exonuclease eri1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W0H
    • Uniprot Q8IV48 (4-203)
    Domains in SCOPe 2.07: d1w0ha_
  • Heterogens: MG, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w0hA (A:)
    gshmadsyydyiciidfeatceegnppefvheiiefpvvllnthtleiedtfqqyvrpei
    ntqlsdfcisltgitqdqvdradtfpqvlkkvidwmklkelgtkykyslltdgswdmskf
    lniqcqlsrlkyppfakkwinirksygnfykvprsqtkltimleklgmdydgrphcgldd
    skniariavrmlqdgcelrinekm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w0hA (A:)
    adsyydyiciidfeatceegnppefvheiiefpvvllnthtleiedtfqqyvrpeintql
    sdfcisltgitqdqvdradtfpqvlkkvidwmklkelgtkykyslltdgswdmskflniq
    cqlsrlkyppfakkwinirksygnfykvprsqtkltimleklgmdydgrphcglddskni
    ariavrmlqdgcelrinekm