PDB entry 1w0e

View 1w0e on RCSB PDB site
Description: crystal structure of human cytochrome p450 3a4
Class: oxidoreductase
Keywords: oxidoreductase, nifedipine oxidase, cytochrome p450, electron transport, monooxygenase
Deposited on 2004-06-03, released 2004-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2436
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 3a4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W0E
      • conflict see remark 9 (369)
    • Uniprot P08684 (2-End)
    Domains in SCOPe 2.07: d1w0ea_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w0eA (A:)
    maygthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvl
    aitdpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgkl
    kemvpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdp
    fventkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrle
    dtqkhrvdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimyela
    thpdvqqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdve
    ingmfipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprnc
    igmrfalmnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrdgtvsg
    ahhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w0eA (A:)
    ygthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlai
    tdpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklke
    mvpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfv
    entkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrlflq
    lmidsdlelvaqsiififagyettssvlsfimyelathpdvqqklqeeidavlpnkappt
    ydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfipkgvvvmipsyalhrdpk
    ywtepekflperfskknkdnidpyiytpfgsgprncigmrfalmnmklalirvlqnfsfk
    pcketqiplklslggllqpekpvvlkvesrdgt