SCOPe 2.08: Structural Classification of Proteins

PDB entry 1w0c

View 1w0c on RCSB PDB site
Description: inhibition of leishmania major pteridine reductase (ptr1) by 2,4,6-triaminoquinazoline; structure of the nadp ternary complex.
Class: oxidoreductase
Keywords: oxidoreductase, enzyme inhibitor, pterin, short-chain reductase, leishmania, methotrexate, trypanosoma, nadp, methotrexate resistance
Deposited on 2004-06-02, released 2004-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.267
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: pteridine reductase
Species: LEISHMANIA MAJOR [TaxId:5664]
Database cross-references and differences (RAF-indexed):
- PDB 1W0C
  - conflict (180)
- Uniprot Q01782 (Start-306)
Domains in SCOPe 2.08: d1w0ca_
Chain 'B':
Compound: pteridine reductase
Species: LEISHMANIA MAJOR [TaxId:5664]
Database cross-references and differences (RAF-indexed):
- PDB 1W0C
  - conflict (180)
- Uniprot Q01782 (Start-306)
Domains in SCOPe 2.08: d1w0cb_
Chain 'C':
Compound: pteridine reductase
Species: LEISHMANIA MAJOR [TaxId:5664]
Database cross-references and differences (RAF-indexed):
- PDB 1W0C
  - conflict (180)
- Uniprot Q01782 (Start-306)
Domains in SCOPe 2.08: d1w0cc_
Chain 'D':
Compound: pteridine reductase
Species: LEISHMANIA MAJOR [TaxId:5664]
Database cross-references and differences (RAF-indexed):
- PDB 1W0C
  - conflict (180)
- Uniprot Q01782 (Start-306)
Domains in SCOPe 2.08: d1w0cd_
Chain 'E':
Compound: pteridine reductase
Species: LEISHMANIA MAJOR [TaxId:5664]
Database cross-references and differences (RAF-indexed):
- PDB 1W0C
  - conflict (180)
- Uniprot Q01782 (Start-306)
Domains in SCOPe 2.08: d1w0ce_
Chain 'F':
Compound: pteridine reductase
Species: LEISHMANIA MAJOR [TaxId:5664]
Database cross-references and differences (RAF-indexed):
- PDB 1W0C
  - conflict (180)
- Uniprot Q01782 (Start-306)
Domains in SCOPe 2.08: d1w0cf_
Chain 'G':
Compound: pteridine reductase
Species: LEISHMANIA MAJOR [TaxId:5664]
Database cross-references and differences (RAF-indexed):
- PDB 1W0C
  - conflict (180)
- Uniprot Q01782 (Start-306)
Domains in SCOPe 2.08: d1w0cg_
Chain 'H':
Compound: pteridine reductase
Species: LEISHMANIA MAJOR [TaxId:5664]
Database cross-references and differences (RAF-indexed):
- PDB 1W0C
  - conflict (180)
- Uniprot Q01782 (Start-306)
Domains in SCOPe 2.08: d1w0ch_
Heterogens: NAP, TAQ, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1w0cA (A:)
lmpteridineredctasemtaptvpvalvtgaakrlgrsiaeglhaegyavclhyhrsa
aeanalsatlnarrpnsaitvqadlsnvatapvsgadgsapvtlftrcaelvaacythwg
rcdvlvnnassfyptpllrndedghepcvgdreametatadlfgsnaiapyflikafahr
vagtpakhrgtnysiinmvdamtnqpllgytiytmakgalegltrsaalelaplqirvng
vgpglsvlvddmppavweghrskvplyqrdssaaevsdvviflcsskakyitgtcvkvdg
gysltra