PDB entry 1w0b

View 1w0b on RCSB PDB site
Description: solution structure of the human alpha-hemoglobin stabilizing protein (ahsp) p30a mutant
Class: chaperone
Keywords: ahsp p30a mutant nmr structure, proline cis/trans isomerization, alpha-thalassaemia, alpha-hemoglobin binding, chaperone
Deposited on 2004-06-02, released 2004-06-10
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-03, with a file datestamp of 2007-07-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: alpha-hemoglobin stabilizing protein
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NZD4 (0-101)
    • engineered mutation (29)
  Domains in SCOP 1.73: d1w0ba_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1w0bA (A:)
  sallkankdlisaglkefsvllnqqvfndalvseedmvtvvedwmnfyinyyrqqvtgep
  qerdkalqelrqelntlanpflakyrdflkshelpshpppss