PDB entry 1w0a

View 1w0a on RCSB PDB site
Description: Solution structure of the trans form of the human alpha-hemoglobin stabilizing protein (AHSP)
Class: chaperone
Keywords: ahsp nmr structure, proline cis/trans isomerization, alpha-thalassaemia, alpha-hemoglobin binding, chaperone
Deposited on 2004-06-02, released 2004-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-hemoglobin stabilizing protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w0aa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w0aA (A:)
    llkankdlisaglkefsvllnqqvfndplvseedmvtvvedwmnfyinyyrqqvtgepqe
    rdkalqelrqelntlanpflakyrdflkshel