PDB entry 1w09

View 1w09 on RCSB PDB site
Description: solution structure of the cis form of the human alpha-hemoglobin stabilizing protein (ahsp)
Class: chaperone
Keywords: ahsp nmr structure, proline cis/trans isomerization, alpha-thalassaemia, alpha-hemoglobin binding, chaperone
Deposited on 2004-06-02, released 2004-06-10
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-03, with a file datestamp of 2007-07-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-hemoglobin stabilizing protein
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1w09a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w09A (A:)
    llkankdlisaglkefsvllnqqvfndplvseedmvtvvedwmnfyinyyrqqvtgepqe
    rdkalqelrqelntlanpflakyrdflkshel