PDB entry 1w09

View 1w09 on RCSB PDB site
Description: Solution structure of the cis form of the human alpha-hemoglobin stabilizing protein (AHSP)
Class: chaperone
Keywords: ahsp nmr structure, proline cis/trans isomerization, alpha-thalassaemia, alpha-hemoglobin binding, chaperone
Deposited on 2004-06-02, released 2004-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: alpha-hemoglobin stabilizing protein
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NZD4 (0-91)
  Domains in SCOPe 2.08: d1w09a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1w09A (A:)
  llkankdlisaglkefsvllnqqvfndplvseedmvtvvedwmnfyinyyrqqvtgepqe
  rdkalqelrqelntlanpflakyrdflkshel