PDB entry 1w07

View 1w07 on RCSB PDB site
Description: arabidopsis thaliana acyl-coa oxidase 1
Class: oxidoreductase
Keywords: oxidoreductase, peroxisomal beta-oxidation, fad cofactor
Deposited on 2004-06-01, released 2004-12-15
The last revision prior to the SCOP 1.73 freeze date was dated 2004-12-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.204
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-CoA oxidase
    Species: Arabidopsis thaliana
    Database cross-references and differences (RAF-indexed):
    • Uniprot O65202 (Start-658)
      • engineered mutation (154)
    Domains in SCOP 1.73: d1w07a1, d1w07a2, d1w07a3
  • Chain 'B':
    Compound: acyl-CoA oxidase
    Species: Arabidopsis thaliana
    Database cross-references and differences (RAF-indexed):
    • Uniprot O65202 (Start-658)
      • engineered mutation (154)
    Domains in SCOP 1.73: d1w07b1, d1w07b2, d1w07b3
  • Heterogens: CA, CL, PT, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w07A (A:)
    megidhladernkaefdvedmkivwagsrhafevsdriarlvasdpvfeksnrarlsrke
    lfkstlrkcahafkriielrlneeeagrlrhfidqpayvdlhwgmfvpaikgqgteeqqk
    kwlslankmqiigcyaqtelghgsnvqglettatldpktdefvihtptqtaskwwpgglg
    kvsthavvyarlitngkdygihgfivqlrsledhsplpnitvgdigtkmgngaynsmdng
    flmfdhvriprdqmlmrlskvtregeyvpsdvpkqlvygtmvyvrqtivadasnalsrav
    ciatrysavrrqfgahnggietqvidyktqqnrlfpllasayafrfvgewlkwlytdvte
    rlaasdfatlpeahactaglksltttatadgieecrklcgghgylwcsglpelfavyvpa
    ctyegdnvvlqlqvarflmktvaqlgsgkvpvgttaymgraahllqcrsgvqkaedwlnp
    dvvleafearalrmavtcaknlskfenqeqgfqelladlveaaiahcqlivvskfiakle
    qdiggkgvkkqlnnlcyiyalyllhkhlgdflstncitpkqaslandqlrslytqvrpna
    valvdafnytdhylnsvlgrydgnvypklfeealkdplndsvvpdgyqeylrpvlqqql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w07A (A:)
    egidhladernkaefdvedmkivwagsrhafevsdriarlvasdpvfeksnrarlsrkel
    fkstlrkcahafkriielrlneeeagrlrhfidqpayvdlhwgmfvpaikgqgteeqqkk
    wlslankmqiigcyaqtelghgsnvqglettatldpktdefvihtptqtaskwwpgglgk
    vsthavvyarlitngkdygihgfivqlrsledhsplpnitvgdigtkmgngaynsmdngf
    lmfdhvriprdqmlmrlskvtregeyvpsdvpkqlvygtmvyvrqtivadasnalsravc
    iatrysavrrqfgagietqvidyktqqnrlfpllasayafrfvgewlkwlytdvterlaa
    sdfatlpeahactaglksltttatadgieecrklcgghgylwcsglpelfavyvpactye
    gdnvvlqlqvarflmktvaqlgsgkvpvgttaymgraahllqcrsgvqkaedwlnpdvvl
    eafearalrmavtcaknlskfenqeqgfqelladlveaaiahcqlivvskfiakleqdig
    gkgvkkqlnnlcyiyalyllhkhlgdflstncitpkqaslandqlrslytqvrpnavalv
    dafnytdhylnsvlgrydgnvypklfeealkdplndsvvpdgyqeylrpvlqqql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w07B (B:)
    megidhladernkaefdvedmkivwagsrhafevsdriarlvasdpvfeksnrarlsrke
    lfkstlrkcahafkriielrlneeeagrlrhfidqpayvdlhwgmfvpaikgqgteeqqk
    kwlslankmqiigcyaqtelghgsnvqglettatldpktdefvihtptqtaskwwpgglg
    kvsthavvyarlitngkdygihgfivqlrsledhsplpnitvgdigtkmgngaynsmdng
    flmfdhvriprdqmlmrlskvtregeyvpsdvpkqlvygtmvyvrqtivadasnalsrav
    ciatrysavrrqfgahnggietqvidyktqqnrlfpllasayafrfvgewlkwlytdvte
    rlaasdfatlpeahactaglksltttatadgieecrklcgghgylwcsglpelfavyvpa
    ctyegdnvvlqlqvarflmktvaqlgsgkvpvgttaymgraahllqcrsgvqkaedwlnp
    dvvleafearalrmavtcaknlskfenqeqgfqelladlveaaiahcqlivvskfiakle
    qdiggkgvkkqlnnlcyiyalyllhkhlgdflstncitpkqaslandqlrslytqvrpna
    valvdafnytdhylnsvlgrydgnvypklfeealkdplndsvvpdgyqeylrpvlqqql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w07B (B:)
    egidhladernkaefdvedmkivwagsrhafevsdriarlvasdpvfeksnrarlsrkel
    fkstlrkcahafkriielrlneeeagrlrhfidqpayvdlhwgmfvpaikgqgteeqqkk
    wlslankmqiigcyaqtelghgsnvqglettatldpktdefvihtptqtaskwwpgglgk
    vsthavvyarlitngkdygihgfivqlrsledhsplpnitvgdigtkmgngaynsmdngf
    lmfdhvriprdqmlmrlskvtregeyvpsdvpkqlvygtmvyvrqtivadasnalsravc
    iatrysavrrqfgahnggietqvidyktqqnrlfpllasayafrfvgewlkwlytdvter
    laasdfatlpeahactaglksltttatadgieecrklcgghgylwcsglpelfavyvpac
    tyegdnvvlqlqvarflmktvaqlgsgkvpvgttaymgraahllqcrsgvqkaedwlnpd
    vvleafearalrmavtcaknlskfenqeqgfqelladlveaaiahcqlivvskfiakleq
    diggkgvkkqlnnlcyiyalyllhkhlgdflstncitpkqaslandqlrslytqvrpnav
    alvdafnytdhylnsvlgrydgnvypklfeealkdplndsvvpdgyqeylrpvlqqql