PDB entry 1w04

View 1w04 on RCSB PDB site
Description: isopenicillin n synthase aminoadipoyl-cysteinyl-glycine-fe-no complex
Class: oxidoreductase
Keywords: oxidoreductase, b-lactam antibiotic, oxygenase, penicillin biosynthesis
Deposited on 2004-06-01, released 2005-05-04
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-04, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: 0.16293
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isopenicillin n synthetase
    Species: Emericella nidulans
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1w04a1
  • Heterogens: FE2, SO4, HCG, NO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w04A (A:)
    mgsvskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktke
    fhmsitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqak
    tpthevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddt
    lasvvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyq
    dieaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdpr
    epngksdreplsygdylqnglvslinkngqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w04A (A:)
    svskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefh
    msitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktp
    thevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtla
    svvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdi
    eaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprep
    ngksdreplsygdylqnglvslinkngqt