PDB entry 1w01

View 1w01 on RCSB PDB site
Description: Crystal structure of mutant enzymes Y57F/D103L of ketosteroid isomerase from Pseudomonas putida biotype B
Class: isomerase
Keywords: isomerase, coneshell, closed barrel, curved b-sheet
Deposited on 2004-05-30, released 2004-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.1
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: steroid delta-isomerase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07445
      • engineered mutation (56)
      • engineered mutation (102)
    Domains in SCOPe 2.07: d1w01a_
  • Chain 'B':
    Compound: steroid delta-isomerase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07445
      • engineered mutation (56)
      • engineered mutation (102)
    Domains in SCOPe 2.07: d1w01b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w01A (A:)
    mnlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaaffrqg
    lgggkvracltgpvrashngcgampfrvemvwngqpcaldvilvmrfdehgriqtmqayw
    sevnlsvrepq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w01A (A:)
    lptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaaffrqglg
    ggkvracltgpvrashngcgampfrvemvwngqpcaldvilvmrfdehgriqtmqaywse
    vnlsv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w01B (B:)
    mnlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaaffrqg
    lgggkvracltgpvrashngcgampfrvemvwngqpcaldvilvmrfdehgriqtmqayw
    sevnlsvrepq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w01B (B:)
    nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaaffrqgl
    gggkvracltgpvrashngcgampfrvemvwngqpcaldvilvmrfdehgriqtmqayws
    evnlsvr