PDB entry 1w00

View 1w00 on RCSB PDB site
Description: Crystal structure of mutant enzyme Y32F of Ketosteroid Isomerase from Pseudomonas putida biotype B
Class: isomerase
Keywords: isomerase, coneshell, closed barrel, curved b-sheet
Deposited on 2004-05-30, released 2005-05-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: steroid delta-isomerase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07445
      • engineered mutation (102)
    Domains in SCOPe 2.08: d1w00a1
  • Chain 'B':
    Compound: steroid delta-isomerase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07445
      • engineered mutation (102)
    Domains in SCOPe 2.08: d1w00b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w00A (A:)
    mnlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqg
    lgggkvracltgpvrashngcgampfrvemvwngqpcaldvilvmrfdehgriqtmqayw
    sevnlsvrepq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w00A (A:)
    nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqgl
    gkvracltgpvrashngcgampfrvemvwngqpcaldvilvmrfdehgriqtmqaywsev
    nlsvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w00B (B:)
    mnlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqg
    lgggkvracltgpvrashngcgampfrvemvwngqpcaldvilvmrfdehgriqtmqayw
    sevnlsvrepq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w00B (B:)
    nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqgl
    kvracltgpvrashngcgampfrvemvwngqpcaldvilvmrfdehgriqtmqaywsevn
    lsvr