PDB entry 1vzz

View 1vzz on RCSB PDB site
Description: crystal structure of mutant enzyme y32f/d103l of ketosteroid isomerase from pseudomonas putida biotype b
Deposited on 2004-05-30, released 2004-07-08
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-08, with a file datestamp of 2004-07-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1vzza_
  • Chain 'B':
    Domains in SCOP 1.69: d1vzzb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vzzA (A:)
    mnlptaqevqglmaryielvdvgdieaivqmfaddatvedpfgqppihgreqiaafyrqg
    lgggkvracltgpvrashngcgampfrvemvwngqpcaldvilvmrfdehgriqtmqayw
    sevnlsvrepq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vzzA (A:)
    nlptaqevqglmaryielvdvgdieaivqmfaddatvedpfgqppihgreqiaafyrqgl
    gkvracltgpvrashngcgampfrvemvpcaldvilvmrfdehgriqtmqaywsevnlsv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vzzB (B:)
    mnlptaqevqglmaryielvdvgdieaivqmfaddatvedpfgqppihgreqiaafyrqg
    lgggkvracltgpvrashngcgampfrvemvwngqpcaldvilvmrfdehgriqtmqayw
    sevnlsvrepq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vzzB (B:)
    nlptaqevqglmaryielvdvgdieaivqmfaddatvedpfgqppihgreqiaafyrqgl
    gkvracltgpvrashngcgampfrvemvwngqpcaldvilvmrfdehgriqtmqaywsev
    nlsv